Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 1419329..1419546 | Replicon | chromosome |
Accession | NZ_CP064096 | ||
Organism | Bacillus subtilis strain N1142-3at |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | IRJ28_RS07680 | Protein ID | WP_009967515.1 |
Coordinates | 1419370..1419546 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 1419329..1419429 (-) |
Genomic Context
Location: 1417943..1418269 (327 bp)
Type: Others
Protein ID: WP_009967517.1
Type: Others
Protein ID: WP_009967517.1
Location: 1418384..1418995 (612 bp)
Type: Others
Protein ID: WP_009967516.1
Type: Others
Protein ID: WP_009967516.1
Location: 1419370..1419546 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1
Type: Toxin
Protein ID: WP_009967515.1
Location: 1419565..1419816 (252 bp)
Type: Others
Protein ID: WP_010886546.1
Type: Others
Protein ID: WP_010886546.1
Location: 1419861..1420049 (189 bp)
Type: Others
Protein ID: WP_004399547.1
Type: Others
Protein ID: WP_004399547.1
Location: 1420131..1421363 (1233 bp)
Type: Others
Protein ID: WP_004399445.1
Type: Others
Protein ID: WP_004399445.1
Location: 1421691..1422197 (507 bp)
Type: Others
Protein ID: WP_004399486.1
Type: Others
Protein ID: WP_004399486.1
Location: 1422554..1423870 (1317 bp)
Type: Others
Protein ID: WP_004399369.1
Type: Others
Protein ID: WP_004399369.1
Location: 1424131..1424358 (228 bp)
Type: Others
Protein ID: WP_004399298.1
Type: Others
Protein ID: WP_004399298.1
Location: 1416796..1416990 (195 bp)
Type: Others
Protein ID: WP_004399291.1
Type: Others
Protein ID: WP_004399291.1
Location: 1419329..1419429 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 1419329..1419429 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 1419329..1419429 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 1419329..1419429 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IRJ28_RS07665 (1416796) | 1416796..1416990 | - | 195 | WP_004399291.1 | hypothetical protein | - |
IRJ28_RS07670 (1417943) | 1417943..1418269 | + | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
IRJ28_RS07675 (1418384) | 1418384..1418995 | + | 612 | WP_009967516.1 | lipoprotein | - |
- (1419329) | 1419329..1419429 | - | 101 | NuclAT_2 | - | Antitoxin |
- (1419329) | 1419329..1419429 | - | 101 | NuclAT_2 | - | Antitoxin |
- (1419329) | 1419329..1419429 | - | 101 | NuclAT_2 | - | Antitoxin |
- (1419329) | 1419329..1419429 | - | 101 | NuclAT_2 | - | Antitoxin |
IRJ28_RS07680 (1419370) | 1419370..1419546 | + | 177 | WP_009967515.1 | hypothetical protein | Toxin |
IRJ28_RS07685 (1419565) | 1419565..1419816 | + | 252 | WP_010886546.1 | hypothetical protein | - |
IRJ28_RS07690 (1419861) | 1419861..1420049 | + | 189 | WP_004399547.1 | hypothetical protein | - |
IRJ28_RS07695 (1420131) | 1420131..1421363 | + | 1233 | WP_004399445.1 | hypothetical protein | - |
IRJ28_RS07700 (1421691) | 1421691..1422197 | + | 507 | WP_004399486.1 | hypothetical protein | - |
IRJ28_RS07705 (1422554) | 1422554..1423870 | + | 1317 | WP_004399369.1 | hypothetical protein | - |
IRJ28_RS07710 (1424131) | 1424131..1424358 | + | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1327445..1487704 | 160259 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T180107 WP_009967515.1 NZ_CP064096:1419370-1419546 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
>T180107 NZ_CP085064:c121575-121270 [Escherichia coli]
ATGCAGTTTAAGGTTTACACCTATAAAAGAGAGAGCCGTTATCGTCTGTTTGTGGATGTACAGAGTGATATTATTGACAC
GCCCGGGCGACGGATGGTGATCCCCCTGGCCAGTGCACGTCTGCTGTCAGATAAAGTCTCCCGTGAACTTTACCCGGTGG
TGCATATCGGGGATGAAAGCTGGCGCATGATGACCACCGATATGGCCAGTGTGCCGGTCTCCGTTATCGGGGAAGAAGTG
GCTGATCTCAGCCACCGCGAAAATGACATCAAAAACGCCATTAACCTGATGTTCTGGGGAATATAA
ATGCAGTTTAAGGTTTACACCTATAAAAGAGAGAGCCGTTATCGTCTGTTTGTGGATGTACAGAGTGATATTATTGACAC
GCCCGGGCGACGGATGGTGATCCCCCTGGCCAGTGCACGTCTGCTGTCAGATAAAGTCTCCCGTGAACTTTACCCGGTGG
TGCATATCGGGGATGAAAGCTGGCGCATGATGACCACCGATATGGCCAGTGTGCCGGTCTCCGTTATCGGGGAAGAAGTG
GCTGATCTCAGCCACCGCGAAAATGACATCAAAAACGCCATTAACCTGATGTTCTGGGGAATATAA
Antitoxin
Download Length: 101 bp
>AT180107 NZ_CP064096:c1419429-1419329 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | O31941 |
Antitoxin
Download structure file