Detailed information of TA system TA180107

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): yonT-as-bsrG/-
• Location: 1419329..1419546
• Replicon: chromosome
• Accession: NZ_CP064096
• Organism: Bacillus subtilis strain N1142-3at

Toxin (Protein)

• Gene name: yonT
• Uniprot ID: O31941
• Locus tag: IRJ28_RS07680
• Protein ID: WP_009967515.1
• Coordinates: 1419370..1419546 (+)
• Length: 59 a.a.

Antitoxin (RNA)

Gene name	as-bsrG
Locus tag	-
Coordinates	1419329..1419429 (-)

Genomic Context

Location: 1417943..1418269 (327 bp)
Type: Others
Protein ID: WP_009967517.1

Location: 1418384..1418995 (612 bp)
Type: Others
Protein ID: WP_009967516.1

Location: 1419370..1419546 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1

Location: 1419565..1419816 (252 bp)
Type: Others
Protein ID: WP_010886546.1

Location: 1419861..1420049 (189 bp)
Type: Others
Protein ID: WP_004399547.1

Location: 1420131..1421363 (1233 bp)
Type: Others
Protein ID: WP_004399445.1

Location: 1421691..1422197 (507 bp)
Type: Others
Protein ID: WP_004399486.1

Location: 1422554..1423870 (1317 bp)
Type: Others
Protein ID: WP_004399369.1

Location: 1424131..1424358 (228 bp)
Type: Others
Protein ID: WP_004399298.1

Location: 1416796..1416990 (195 bp)
Type: Others
Protein ID: WP_004399291.1

Location: 1419329..1419429 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 1419329..1419429 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 1419329..1419429 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 1419329..1419429 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
IRJ28_RS07665 (1416796)	1416796..1416990	-	195	WP_004399291.1	hypothetical protein	-
IRJ28_RS07670 (1417943)	1417943..1418269	+	327	WP_009967517.1	helix-turn-helix transcriptional regulator	-
IRJ28_RS07675 (1418384)	1418384..1418995	+	612	WP_009967516.1	lipoprotein	-
- (1419329)	1419329..1419429	-	101	NuclAT_2	-	Antitoxin
- (1419329)	1419329..1419429	-	101	NuclAT_2	-	Antitoxin
- (1419329)	1419329..1419429	-	101	NuclAT_2	-	Antitoxin
- (1419329)	1419329..1419429	-	101	NuclAT_2	-	Antitoxin
IRJ28_RS07680 (1419370)	1419370..1419546	+	177	WP_009967515.1	hypothetical protein	Toxin
IRJ28_RS07685 (1419565)	1419565..1419816	+	252	WP_010886546.1	hypothetical protein	-
IRJ28_RS07690 (1419861)	1419861..1420049	+	189	WP_004399547.1	hypothetical protein	-
IRJ28_RS07695 (1420131)	1420131..1421363	+	1233	WP_004399445.1	hypothetical protein	-
IRJ28_RS07700 (1421691)	1421691..1422197	+	507	WP_004399486.1	hypothetical protein	-
IRJ28_RS07705 (1422554)	1422554..1423870	+	1317	WP_004399369.1	hypothetical protein	-
IRJ28_RS07710 (1424131)	1424131..1424358	+	228	WP_004399298.1	helix-turn-helix transcriptional regulator	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0.004	inside	Prophage	-	-	1327445..1487704	160259

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Sequences

Toxin

Protein

• Length: 59 a.a.
• Molecular weight: 6882.45 Da
• Isoelectric Point: 12.8833

>T180107 WP_009967515.1 NZ_CP064096:1419370-1419546 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR

Nucleotide

• Length: 177 bp

>T180107 NZ_CP085064:c121575-121270 [Escherichia coli]
ATGCAGTTTAAGGTTTACACCTATAAAAGAGAGAGCCGTTATCGTCTGTTTGTGGATGTACAGAGTGATATTATTGACAC
GCCCGGGCGACGGATGGTGATCCCCCTGGCCAGTGCACGTCTGCTGTCAGATAAAGTCTCCCGTGAACTTTACCCGGTGG
TGCATATCGGGGATGAAAGCTGGCGCATGATGACCACCGATATGGCCAGTGTGCCGGTCTCCGTTATCGGGGAAGAAGTG
GCTGATCTCAGCCACCGCGAAAATGACATCAAAAACGCCATTAACCTGATGTTCTGGGGAATATAA

Antitoxin

Nucleotide

• Length: 101 bp

>AT180107 NZ_CP064096:c1419429-1419329 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: O31941

Antitoxin