Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) bsrG-as-bsrH/-
Location 1638324..1638614 Replicon chromosome
Accession NZ_CP120681
Organism Bacillus subtilis strain DSM 10

Toxin (Protein)


Gene name bsrG Uniprot ID L8EAY0
Locus tag P5655_RS08885 Protein ID WP_009967548.1
Coordinates 1638324..1638440 (+) Length 39 a.a.

Antitoxin (RNA)


Gene name as-bsrH
Locus tag -
Coordinates 1638435..1638614 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5655_RS08850 (1634251) 1634251..1634421 - 171 WP_009967544.1 bacteriocin sublancin-168 -
P5655_RS08855 (1634718) 1634718..1635035 - 318 WP_009967545.1 sublancin immunity protein SunI -
P5655_RS08860 (1635137) 1635137..1636387 - 1251 WP_004398504.1 UV-damage repair protein uvrX -
P5655_RS08865 (1636380) 1636380..1636712 - 333 WP_004398710.1 YolD-like family protein -
P5655_RS08870 (1636886) 1636886..1637221 + 336 WP_004399073.1 hypothetical protein -
P5655_RS08875 (1637264) 1637264..1637620 - 357 WP_004398595.1 hypothetical protein -
P5655_RS08880 (1637626) 1637626..1638093 - 468 WP_003246138.1 YolA family protein -
P5655_RS08885 (1638324) 1638324..1638440 + 117 WP_009967548.1 type I toxin-antitoxin system toxin BsrG Toxin
- (1638435) 1638435..1638614 - 180 NuclAT_1 - Antitoxin
- (1638435) 1638435..1638614 - 180 NuclAT_1 - Antitoxin
- (1638435) 1638435..1638614 - 180 NuclAT_1 - Antitoxin
- (1638435) 1638435..1638614 - 180 NuclAT_1 - Antitoxin
P5655_RS08890 (1638719) 1638719..1639252 - 534 WP_004399156.1 GNAT family protein -
P5655_RS08895 (1639288) 1639288..1639866 - 579 WP_004399123.1 SMI1/KNR4 family protein -
P5655_RS08900 (1639930) 1639930..1640427 - 498 WP_003246188.1 SMI1/KNR4 family protein -
P5655_RS08905 (1640436) 1640436..1642151 - 1716 WP_004398855.1 ribonuclease YeeF family protein -
P5655_RS08910 (1642251) 1642251..1642808 - 558 WP_003246042.1 SMI1/KNR4 family protein -
P5655_RS08915 (1642943) 1642943..1643077 + 135 WP_234047931.1 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1516355..1665384 149029


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Small toxic protein BsrE-like

(1-38)


Sequences

Toxin        


Download         Length: 39 a.a.        Molecular weight: 4336.39 Da        Isoelectric Point: 10.1022

>T275361 WP_009967548.1 NZ_CP120681:1638324-1638440 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Download         Length: 117 bp

Antitoxin


Download         Length: 180 bp

>AT275361 NZ_CP120681:c1638614-1638435 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Z7EVU9

Antitoxin

Download structure file

References