Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | bsrG-as-bsrH/- |
| Location | 2273205..2273495 | Replicon | chromosome |
| Accession | NZ_CP125660 | ||
| Organism | Bacillus subtilis strain GUCC48 | ||
Toxin (Protein)
| Gene name | bsrG | Uniprot ID | L8EAY0 |
| Locus tag | QLH41_RS11740 | Protein ID | WP_009967548.1 |
| Coordinates | 2273205..2273321 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrH | ||
| Locus tag | - | ||
| Coordinates | 2273316..2273495 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLH41_RS11705 (2269132) | 2269132..2269302 | - | 171 | WP_009967544.1 | bacteriocin sublancin-168 | - |
| QLH41_RS11710 (2269599) | 2269599..2269916 | - | 318 | WP_009967545.1 | sublancin immunity protein SunI | - |
| QLH41_RS11715 (2270018) | 2270018..2271268 | - | 1251 | WP_004398504.1 | UV-damage repair protein uvrX | - |
| QLH41_RS11720 (2271261) | 2271261..2271593 | - | 333 | WP_004398710.1 | YolD-like family protein | - |
| QLH41_RS11725 (2271767) | 2271767..2272102 | + | 336 | WP_004399073.1 | hypothetical protein | - |
| QLH41_RS11730 (2272145) | 2272145..2272501 | - | 357 | WP_004398595.1 | hypothetical protein | - |
| QLH41_RS11735 (2272507) | 2272507..2272974 | - | 468 | WP_003246138.1 | YolA family protein | - |
| QLH41_RS11740 (2273205) | 2273205..2273321 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
| - (2273316) | 2273316..2273495 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2273316) | 2273316..2273495 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2273316) | 2273316..2273495 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2273316) | 2273316..2273495 | - | 180 | NuclAT_1 | - | Antitoxin |
| QLH41_RS11745 (2273600) | 2273600..2274133 | - | 534 | WP_004399156.1 | GNAT family protein | - |
| QLH41_RS11750 (2274169) | 2274169..2274747 | - | 579 | WP_004399123.1 | SMI1/KNR4 family protein | - |
| QLH41_RS11755 (2274811) | 2274811..2275308 | - | 498 | WP_003246188.1 | SMI1/KNR4 family protein | - |
| QLH41_RS11760 (2275317) | 2275317..2277032 | - | 1716 | WP_004398855.1 | ribonuclease YeeF family protein | - |
| QLH41_RS11765 (2277132) | 2277132..2277689 | - | 558 | WP_003246042.1 | SMI1/KNR4 family protein | - |
| QLH41_RS11770 (2277824) | 2277824..2277958 | + | 135 | WP_234047931.1 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2151237..2286019 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T282262 WP_009967548.1 NZ_CP125660:2273205-2273321 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
Antitoxin
Download Length: 180 bp
>AT282262 NZ_CP125660:c2273495-2273316 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|