Detailed information of TA system TA282262

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): bsrG-as-bsrH/-
• Location: 2273205..2273495
• Replicon: chromosome
• Accession: NZ_CP125660
• Organism: Bacillus subtilis strain GUCC48

Toxin (Protein)

• Gene name: bsrG
• Uniprot ID: L8EAY0
• Locus tag: QLH41_RS11740
• Protein ID: WP_009967548.1
• Coordinates: 2273205..2273321 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	as-bsrH
Locus tag	-
Coordinates	2273316..2273495 (-)

Genomic Context

Location: 2271767..2272102 (336 bp)
Type: Others
Protein ID: WP_004399073.1

Location: 2273205..2273321 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1

Location: 2277824..2277958 (135 bp)
Type: Others
Protein ID: WP_234047931.1

Location: 2269132..2269302 (171 bp)
Type: Others
Protein ID: WP_009967544.1

Location: 2269599..2269916 (318 bp)
Type: Others
Protein ID: WP_009967545.1

Location: 2270018..2271268 (1251 bp)
Type: Others
Protein ID: WP_004398504.1

Location: 2271261..2271593 (333 bp)
Type: Others
Protein ID: WP_004398710.1

Location: 2272145..2272501 (357 bp)
Type: Others
Protein ID: WP_004398595.1

Location: 2272507..2272974 (468 bp)
Type: Others
Protein ID: WP_003246138.1

Location: 2273316..2273495 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2273316..2273495 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2273316..2273495 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2273316..2273495 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2273600..2274133 (534 bp)
Type: Others
Protein ID: WP_004399156.1

Location: 2274169..2274747 (579 bp)
Type: Others
Protein ID: WP_004399123.1

Location: 2274811..2275308 (498 bp)
Type: Others
Protein ID: WP_003246188.1

Location: 2275317..2277032 (1716 bp)
Type: Others
Protein ID: WP_004398855.1

Location: 2277132..2277689 (558 bp)
Type: Others
Protein ID: WP_003246042.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QLH41_RS11705 (2269132)	2269132..2269302	-	171	WP_009967544.1	bacteriocin sublancin-168	-
QLH41_RS11710 (2269599)	2269599..2269916	-	318	WP_009967545.1	sublancin immunity protein SunI	-
QLH41_RS11715 (2270018)	2270018..2271268	-	1251	WP_004398504.1	UV-damage repair protein uvrX	-
QLH41_RS11720 (2271261)	2271261..2271593	-	333	WP_004398710.1	YolD-like family protein	-
QLH41_RS11725 (2271767)	2271767..2272102	+	336	WP_004399073.1	hypothetical protein	-
QLH41_RS11730 (2272145)	2272145..2272501	-	357	WP_004398595.1	hypothetical protein	-
QLH41_RS11735 (2272507)	2272507..2272974	-	468	WP_003246138.1	YolA family protein	-
QLH41_RS11740 (2273205)	2273205..2273321	+	117	WP_009967548.1	type I toxin-antitoxin system toxin BsrG	Toxin
- (2273316)	2273316..2273495	-	180	NuclAT_1	-	Antitoxin
- (2273316)	2273316..2273495	-	180	NuclAT_1	-	Antitoxin
- (2273316)	2273316..2273495	-	180	NuclAT_1	-	Antitoxin
- (2273316)	2273316..2273495	-	180	NuclAT_1	-	Antitoxin
QLH41_RS11745 (2273600)	2273600..2274133	-	534	WP_004399156.1	GNAT family protein	-
QLH41_RS11750 (2274169)	2274169..2274747	-	579	WP_004399123.1	SMI1/KNR4 family protein	-
QLH41_RS11755 (2274811)	2274811..2275308	-	498	WP_003246188.1	SMI1/KNR4 family protein	-
QLH41_RS11760 (2275317)	2275317..2277032	-	1716	WP_004398855.1	ribonuclease YeeF family protein	-
QLH41_RS11765 (2277132)	2277132..2277689	-	558	WP_003246042.1	SMI1/KNR4 family protein	-
QLH41_RS11770 (2277824)	2277824..2277958	+	135	WP_234047931.1	transposase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0	inside	Prophage	-	-	2151237..2286019	134782

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-38)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4336.39 Da
• Isoelectric Point: 10.1022

>T282262 WP_009967548.1 NZ_CP125660:2273205-2273321 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Nucleotide

• Length: 117 bp

Antitoxin

Nucleotide

• Length: 180 bp

>AT282262 NZ_CP125660:c2273495-2273316 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A7Z7EVU9

Antitoxin