Detailed information of TA system TA038972

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): yonT-as-bsrG/-
• Location: 2199085..2199302
• Replicon: chromosome
• Accession: NZ_AP024621
• Organism: Bacillus subtilis strain BEST3095

Toxin (Protein)

• Gene name: yonT
• Uniprot ID: O31941
• Locus tag: K6J89_RS11290
• Protein ID: WP_009967515.1
• Coordinates: 2199085..2199261 (-)
• Length: 59 a.a.

Antitoxin (RNA)

Gene name	as-bsrG
Locus tag	-
Coordinates	2199202..2199302 (+)

Genomic Context

Location: 2199202..2199302 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2199202..2199302 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2199202..2199302 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2199202..2199302 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2201641..2201835 (195 bp)
Type: Others
Protein ID: WP_004399291.1

Location: 2194273..2194500 (228 bp)
Type: Others
Protein ID: WP_004399298.1

Location: 2194761..2196077 (1317 bp)
Type: Others
Protein ID: WP_004399369.1

Location: 2196434..2196940 (507 bp)
Type: Others
Protein ID: WP_004399486.1

Location: 2197268..2198500 (1233 bp)
Type: Others
Protein ID: WP_004399445.1

Location: 2198582..2198770 (189 bp)
Type: Others
Protein ID: WP_004399547.1

Location: 2198815..2199066 (252 bp)
Type: Others
Protein ID: WP_010886546.1

Location: 2199085..2199261 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1

Location: 2199636..2200247 (612 bp)
Type: Others
Protein ID: WP_009967516.1

Location: 2200362..2200688 (327 bp)
Type: Others
Protein ID: WP_009967517.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
K6J89_RS11260 (2194273)	2194273..2194500	-	228	WP_004399298.1	helix-turn-helix transcriptional regulator	-
K6J89_RS11265 (2194761)	2194761..2196077	-	1317	WP_004399369.1	hypothetical protein	-
K6J89_RS11270 (2196434)	2196434..2196940	-	507	WP_004399486.1	hypothetical protein	-
K6J89_RS11275 (2197268)	2197268..2198500	-	1233	WP_004399445.1	hypothetical protein	-
K6J89_RS11280 (2198582)	2198582..2198770	-	189	WP_004399547.1	hypothetical protein	-
K6J89_RS11285 (2198815)	2198815..2199066	-	252	WP_010886546.1	hypothetical protein	-
K6J89_RS11290 (2199085)	2199085..2199261	-	177	WP_009967515.1	hypothetical protein	Toxin
- (2199202)	2199202..2199302	+	101	NuclAT_2	-	Antitoxin
- (2199202)	2199202..2199302	+	101	NuclAT_2	-	Antitoxin
- (2199202)	2199202..2199302	+	101	NuclAT_2	-	Antitoxin
- (2199202)	2199202..2199302	+	101	NuclAT_2	-	Antitoxin
K6J89_RS11295 (2199636)	2199636..2200247	-	612	WP_009967516.1	lipoprotein	-
K6J89_RS11300 (2200362)	2200362..2200688	-	327	WP_009967517.1	helix-turn-helix transcriptional regulator	-
K6J89_RS11305 (2201641)	2201641..2201835	+	195	WP_004399291.1	hypothetical protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0	inside	Prophage	-	-	2130929..2265709	134780

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 59 a.a.
• Molecular weight: 6882.45 Da
• Isoelectric Point: 12.8833

>T38972 WP_009967515.1 NZ_AP024621:c2199261-2199085 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR

Nucleotide

• Length: 177 bp

>T38972 NZ_AP024621:c2199261-2199085 [Bacillus subtilis]
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA

Antitoxin

Nucleotide

• Length: 101 bp

>AT38972 NZ_AP024621:2199202-2199302 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: O31941

Antitoxin