Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 2199085..2199302 | Replicon | chromosome |
Accession | NZ_AP024621 | ||
Organism | Bacillus subtilis strain BEST3095 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | K6J89_RS11290 | Protein ID | WP_009967515.1 |
Coordinates | 2199085..2199261 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 2199202..2199302 (+) |
Genomic Context
Location: 2199202..2199302 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 2199202..2199302 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 2199202..2199302 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 2199202..2199302 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 2201641..2201835 (195 bp)
Type: Others
Protein ID: WP_004399291.1
Type: Others
Protein ID: WP_004399291.1
Location: 2194273..2194500 (228 bp)
Type: Others
Protein ID: WP_004399298.1
Type: Others
Protein ID: WP_004399298.1
Location: 2194761..2196077 (1317 bp)
Type: Others
Protein ID: WP_004399369.1
Type: Others
Protein ID: WP_004399369.1
Location: 2196434..2196940 (507 bp)
Type: Others
Protein ID: WP_004399486.1
Type: Others
Protein ID: WP_004399486.1
Location: 2197268..2198500 (1233 bp)
Type: Others
Protein ID: WP_004399445.1
Type: Others
Protein ID: WP_004399445.1
Location: 2198582..2198770 (189 bp)
Type: Others
Protein ID: WP_004399547.1
Type: Others
Protein ID: WP_004399547.1
Location: 2198815..2199066 (252 bp)
Type: Others
Protein ID: WP_010886546.1
Type: Others
Protein ID: WP_010886546.1
Location: 2199085..2199261 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1
Type: Toxin
Protein ID: WP_009967515.1
Location: 2199636..2200247 (612 bp)
Type: Others
Protein ID: WP_009967516.1
Type: Others
Protein ID: WP_009967516.1
Location: 2200362..2200688 (327 bp)
Type: Others
Protein ID: WP_009967517.1
Type: Others
Protein ID: WP_009967517.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J89_RS11260 (2194273) | 2194273..2194500 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
K6J89_RS11265 (2194761) | 2194761..2196077 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
K6J89_RS11270 (2196434) | 2196434..2196940 | - | 507 | WP_004399486.1 | hypothetical protein | - |
K6J89_RS11275 (2197268) | 2197268..2198500 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
K6J89_RS11280 (2198582) | 2198582..2198770 | - | 189 | WP_004399547.1 | hypothetical protein | - |
K6J89_RS11285 (2198815) | 2198815..2199066 | - | 252 | WP_010886546.1 | hypothetical protein | - |
K6J89_RS11290 (2199085) | 2199085..2199261 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- (2199202) | 2199202..2199302 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2199202) | 2199202..2199302 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2199202) | 2199202..2199302 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2199202) | 2199202..2199302 | + | 101 | NuclAT_2 | - | Antitoxin |
K6J89_RS11295 (2199636) | 2199636..2200247 | - | 612 | WP_009967516.1 | lipoprotein | - |
K6J89_RS11300 (2200362) | 2200362..2200688 | - | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
K6J89_RS11305 (2201641) | 2201641..2201835 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2130929..2265709 | 134780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T38972 WP_009967515.1 NZ_AP024621:c2199261-2199085 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
>T38972 NZ_AP024621:c2199261-2199085 [Bacillus subtilis]
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
Antitoxin
Download Length: 101 bp
>AT38972 NZ_AP024621:2199202-2199302 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | O31941 |
Antitoxin
Download structure file