Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | bsrG-as-bsrH/- |
Location | 2252895..2253185 | Replicon | chromosome |
Accession | NZ_AP024621 | ||
Organism | Bacillus subtilis strain BEST3095 |
Toxin (Protein)
Gene name | bsrG | Uniprot ID | L8EAY0 |
Locus tag | K6J89_RS11585 | Protein ID | WP_009967548.1 |
Coordinates | 2252895..2253011 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | as-bsrH | ||
Locus tag | - | ||
Coordinates | 2253006..2253185 (-) |
Genomic Context
Location: 2251457..2251792 (336 bp)
Type: Others
Protein ID: WP_004399073.1
Type: Others
Protein ID: WP_004399073.1
Location: 2252895..2253011 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1
Type: Toxin
Protein ID: WP_009967548.1
Location: 2257514..2257648 (135 bp)
Type: Others
Protein ID: WP_234047931.1
Type: Others
Protein ID: WP_234047931.1
Location: 2248822..2248992 (171 bp)
Type: Others
Protein ID: WP_009967544.1
Type: Others
Protein ID: WP_009967544.1
Location: 2249289..2249606 (318 bp)
Type: Others
Protein ID: WP_009967545.1
Type: Others
Protein ID: WP_009967545.1
Location: 2249708..2250958 (1251 bp)
Type: Others
Protein ID: WP_004398504.1
Type: Others
Protein ID: WP_004398504.1
Location: 2250951..2251283 (333 bp)
Type: Others
Protein ID: WP_004398710.1
Type: Others
Protein ID: WP_004398710.1
Location: 2251835..2252191 (357 bp)
Type: Others
Protein ID: WP_004398595.1
Type: Others
Protein ID: WP_004398595.1
Location: 2252197..2252664 (468 bp)
Type: Others
Protein ID: WP_003246138.1
Type: Others
Protein ID: WP_003246138.1
Location: 2253006..2253185 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2253006..2253185 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2253006..2253185 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2253006..2253185 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2253290..2253823 (534 bp)
Type: Others
Protein ID: WP_004399156.1
Type: Others
Protein ID: WP_004399156.1
Location: 2253859..2254437 (579 bp)
Type: Others
Protein ID: WP_004399123.1
Type: Others
Protein ID: WP_004399123.1
Location: 2254501..2254998 (498 bp)
Type: Others
Protein ID: WP_003246188.1
Type: Others
Protein ID: WP_003246188.1
Location: 2255007..2256722 (1716 bp)
Type: Others
Protein ID: WP_004398855.1
Type: Others
Protein ID: WP_004398855.1
Location: 2256822..2257379 (558 bp)
Type: Others
Protein ID: WP_003246042.1
Type: Others
Protein ID: WP_003246042.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J89_RS11550 (2248822) | 2248822..2248992 | - | 171 | WP_009967544.1 | bacteriocin sublancin-168 | - |
K6J89_RS11555 (2249289) | 2249289..2249606 | - | 318 | WP_009967545.1 | sublancin immunity protein SunI | - |
K6J89_RS11560 (2249708) | 2249708..2250958 | - | 1251 | WP_004398504.1 | UV-damage repair protein uvrX | - |
K6J89_RS11565 (2250951) | 2250951..2251283 | - | 333 | WP_004398710.1 | YolD-like family protein | - |
K6J89_RS11570 (2251457) | 2251457..2251792 | + | 336 | WP_004399073.1 | hypothetical protein | - |
K6J89_RS11575 (2251835) | 2251835..2252191 | - | 357 | WP_004398595.1 | hypothetical protein | - |
K6J89_RS11580 (2252197) | 2252197..2252664 | - | 468 | WP_003246138.1 | YolA family protein | - |
K6J89_RS11585 (2252895) | 2252895..2253011 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
- (2253006) | 2253006..2253185 | - | 180 | NuclAT_1 | - | Antitoxin |
- (2253006) | 2253006..2253185 | - | 180 | NuclAT_1 | - | Antitoxin |
- (2253006) | 2253006..2253185 | - | 180 | NuclAT_1 | - | Antitoxin |
- (2253006) | 2253006..2253185 | - | 180 | NuclAT_1 | - | Antitoxin |
K6J89_RS11590 (2253290) | 2253290..2253823 | - | 534 | WP_004399156.1 | GNAT family protein | - |
K6J89_RS11595 (2253859) | 2253859..2254437 | - | 579 | WP_004399123.1 | SMI1/KNR4 family protein | - |
K6J89_RS11600 (2254501) | 2254501..2254998 | - | 498 | WP_003246188.1 | SMI1/KNR4 family protein | - |
K6J89_RS11605 (2255007) | 2255007..2256722 | - | 1716 | WP_004398855.1 | ribonuclease YeeF family protein | - |
K6J89_RS11610 (2256822) | 2256822..2257379 | - | 558 | WP_003246042.1 | SMI1/KNR4 family protein | - |
K6J89_RS11615 (2257514) | 2257514..2257648 | + | 135 | WP_234047931.1 | transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2130929..2265709 | 134780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T38976 WP_009967548.1 NZ_AP024621:2252895-2253011 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
>T38976 NZ_AP024621:2252895-2253011 [Bacillus subtilis]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
Antitoxin
Download Length: 180 bp
>AT38976 NZ_AP024621:c2253185-2253006 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z7EVU9 |
Antitoxin
Download structure file