Detailed information of TA system TA038976

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): bsrG-as-bsrH/-
• Location: 2252895..2253185
• Replicon: chromosome
• Accession: NZ_AP024621
• Organism: Bacillus subtilis strain BEST3095

Toxin (Protein)

• Gene name: bsrG
• Uniprot ID: L8EAY0
• Locus tag: K6J89_RS11585
• Protein ID: WP_009967548.1
• Coordinates: 2252895..2253011 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	as-bsrH
Locus tag	-
Coordinates	2253006..2253185 (-)

Genomic Context

Location: 2251457..2251792 (336 bp)
Type: Others
Protein ID: WP_004399073.1

Location: 2252895..2253011 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1

Location: 2257514..2257648 (135 bp)
Type: Others
Protein ID: WP_234047931.1

Location: 2248822..2248992 (171 bp)
Type: Others
Protein ID: WP_009967544.1

Location: 2249289..2249606 (318 bp)
Type: Others
Protein ID: WP_009967545.1

Location: 2249708..2250958 (1251 bp)
Type: Others
Protein ID: WP_004398504.1

Location: 2250951..2251283 (333 bp)
Type: Others
Protein ID: WP_004398710.1

Location: 2251835..2252191 (357 bp)
Type: Others
Protein ID: WP_004398595.1

Location: 2252197..2252664 (468 bp)
Type: Others
Protein ID: WP_003246138.1

Location: 2253006..2253185 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2253006..2253185 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2253006..2253185 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2253006..2253185 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2253290..2253823 (534 bp)
Type: Others
Protein ID: WP_004399156.1

Location: 2253859..2254437 (579 bp)
Type: Others
Protein ID: WP_004399123.1

Location: 2254501..2254998 (498 bp)
Type: Others
Protein ID: WP_003246188.1

Location: 2255007..2256722 (1716 bp)
Type: Others
Protein ID: WP_004398855.1

Location: 2256822..2257379 (558 bp)
Type: Others
Protein ID: WP_003246042.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
K6J89_RS11550 (2248822)	2248822..2248992	-	171	WP_009967544.1	bacteriocin sublancin-168	-
K6J89_RS11555 (2249289)	2249289..2249606	-	318	WP_009967545.1	sublancin immunity protein SunI	-
K6J89_RS11560 (2249708)	2249708..2250958	-	1251	WP_004398504.1	UV-damage repair protein uvrX	-
K6J89_RS11565 (2250951)	2250951..2251283	-	333	WP_004398710.1	YolD-like family protein	-
K6J89_RS11570 (2251457)	2251457..2251792	+	336	WP_004399073.1	hypothetical protein	-
K6J89_RS11575 (2251835)	2251835..2252191	-	357	WP_004398595.1	hypothetical protein	-
K6J89_RS11580 (2252197)	2252197..2252664	-	468	WP_003246138.1	YolA family protein	-
K6J89_RS11585 (2252895)	2252895..2253011	+	117	WP_009967548.1	type I toxin-antitoxin system toxin BsrG	Toxin
- (2253006)	2253006..2253185	-	180	NuclAT_1	-	Antitoxin
- (2253006)	2253006..2253185	-	180	NuclAT_1	-	Antitoxin
- (2253006)	2253006..2253185	-	180	NuclAT_1	-	Antitoxin
- (2253006)	2253006..2253185	-	180	NuclAT_1	-	Antitoxin
K6J89_RS11590 (2253290)	2253290..2253823	-	534	WP_004399156.1	GNAT family protein	-
K6J89_RS11595 (2253859)	2253859..2254437	-	579	WP_004399123.1	SMI1/KNR4 family protein	-
K6J89_RS11600 (2254501)	2254501..2254998	-	498	WP_003246188.1	SMI1/KNR4 family protein	-
K6J89_RS11605 (2255007)	2255007..2256722	-	1716	WP_004398855.1	ribonuclease YeeF family protein	-
K6J89_RS11610 (2256822)	2256822..2257379	-	558	WP_003246042.1	SMI1/KNR4 family protein	-
K6J89_RS11615 (2257514)	2257514..2257648	+	135	WP_234047931.1	transposase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0	inside	Prophage	-	-	2130929..2265709	134780

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-38)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4336.39 Da
• Isoelectric Point: 10.1022

>T38976 WP_009967548.1 NZ_AP024621:2252895-2253011 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Nucleotide

• Length: 117 bp

>T38976 NZ_AP024621:2252895-2253011 [Bacillus subtilis]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG

Antitoxin

Nucleotide

• Length: 180 bp

>AT38976 NZ_AP024621:c2253185-2253006 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A7Z7EVU9

Antitoxin