Detailed information of TA system TA039064

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): yonT-as-bsrG/-
• Location: 2185880..2186097
• Replicon: chromosome
• Accession: NZ_AP024625
• Organism: Bacillus subtilis strain BEST3109

Toxin (Protein)

• Gene name: yonT
• Uniprot ID: O31941
• Locus tag: BsBEST3145_RS11215
• Protein ID: WP_009967515.1
• Coordinates: 2185880..2186056 (-)
• Length: 59 a.a.

Antitoxin (RNA)

Gene name	as-bsrG
Locus tag	-
Coordinates	2185997..2186097 (+)

Genomic Context

Location: 2185997..2186097 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2185997..2186097 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2185997..2186097 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2185997..2186097 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2188436..2188630 (195 bp)
Type: Others
Protein ID: WP_004399291.1

Location: 2181068..2181295 (228 bp)
Type: Others
Protein ID: WP_004399298.1

Location: 2181556..2182872 (1317 bp)
Type: Others
Protein ID: WP_004399369.1

Location: 2183229..2183735 (507 bp)
Type: Others
Protein ID: WP_004399486.1

Location: 2184063..2185295 (1233 bp)
Type: Others
Protein ID: WP_004399445.1

Location: 2185377..2185565 (189 bp)
Type: Others
Protein ID: WP_004399547.1

Location: 2185610..2185861 (252 bp)
Type: Others
Protein ID: WP_010886546.1

Location: 2185880..2186056 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1

Location: 2186431..2187042 (612 bp)
Type: Others
Protein ID: WP_009967516.1

Location: 2187157..2187483 (327 bp)
Type: Others
Protein ID: WP_009967517.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BsBEST3145_RS11185 (2181068)	2181068..2181295	-	228	WP_004399298.1	helix-turn-helix transcriptional regulator	-
BsBEST3145_RS11190 (2181556)	2181556..2182872	-	1317	WP_004399369.1	hypothetical protein	-
BsBEST3145_RS11195 (2183229)	2183229..2183735	-	507	WP_004399486.1	hypothetical protein	-
BsBEST3145_RS11200 (2184063)	2184063..2185295	-	1233	WP_004399445.1	hypothetical protein	-
BsBEST3145_RS11205 (2185377)	2185377..2185565	-	189	WP_004399547.1	hypothetical protein	-
BsBEST3145_RS11210 (2185610)	2185610..2185861	-	252	WP_010886546.1	hypothetical protein	-
BsBEST3145_RS11215 (2185880)	2185880..2186056	-	177	WP_009967515.1	hypothetical protein	Toxin
- (2185997)	2185997..2186097	+	101	NuclAT_2	-	Antitoxin
- (2185997)	2185997..2186097	+	101	NuclAT_2	-	Antitoxin
- (2185997)	2185997..2186097	+	101	NuclAT_2	-	Antitoxin
- (2185997)	2185997..2186097	+	101	NuclAT_2	-	Antitoxin
BsBEST3145_RS11220 (2186431)	2186431..2187042	-	612	WP_009967516.1	lipoprotein	-
BsBEST3145_RS11225 (2187157)	2187157..2187483	-	327	WP_009967517.1	helix-turn-helix transcriptional regulator	-
BsBEST3145_RS11230 (2188436)	2188436..2188630	+	195	WP_004399291.1	hypothetical protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0.003	inside	Prophage	-	-	2117724..2266751	149027

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Sequences

Toxin

Protein

• Length: 59 a.a.
• Molecular weight: 6882.45 Da
• Isoelectric Point: 12.8833

>T39064 WP_009967515.1 NZ_AP024625:c2186056-2185880 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR

Nucleotide

• Length: 177 bp

>T39064 NZ_AP024625:c2186056-2185880 [Bacillus subtilis]
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA

Antitoxin

Nucleotide

• Length: 101 bp

>AT39064 NZ_AP024625:2185997-2186097 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: O31941

Antitoxin