Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 2219384..2219601 | Replicon | chromosome |
Accession | NZ_CP102769 | ||
Organism | Bacillus subtilis strain YZSR384 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | NVS73_RS11445 | Protein ID | WP_009967515.1 |
Coordinates | 2219384..2219560 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 2219501..2219601 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NVS73_RS11415 (2214572) | 2214572..2214799 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
NVS73_RS11420 (2215060) | 2215060..2216376 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
NVS73_RS11425 (2216733) | 2216733..2217239 | - | 507 | WP_004399486.1 | hypothetical protein | - |
NVS73_RS11430 (2217567) | 2217567..2218799 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
NVS73_RS11435 (2218881) | 2218881..2219069 | - | 189 | WP_004399547.1 | hypothetical protein | - |
NVS73_RS11440 (2219114) | 2219114..2219365 | - | 252 | WP_010886546.1 | hypothetical protein | - |
NVS73_RS11445 (2219384) | 2219384..2219560 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- (2219501) | 2219501..2219601 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2219501) | 2219501..2219601 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2219501) | 2219501..2219601 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2219501) | 2219501..2219601 | + | 101 | NuclAT_2 | - | Antitoxin |
NVS73_RS11450 (2219935) | 2219935..2220546 | - | 612 | WP_009967516.1 | lipoprotein | - |
NVS73_RS11455 (2220661) | 2220661..2220987 | - | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
NVS73_RS11460 (2221940) | 2221940..2222134 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2151226..2286008 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T254172 WP_009967515.1 NZ_CP102769:c2219560-2219384 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT254172 NZ_CP102769:2219501-2219601 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|