Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 2219544..2219761 | Replicon | chromosome |
Accession | NZ_CP010053 | ||
Organism | Bacillus subtilis strain PS832 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | QX56_RS21770 | Protein ID | WP_009967515.1 |
Coordinates | 2219544..2219720 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 2219661..2219761 (+) |
Genomic Context
Location: 2219661..2219761 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 2219661..2219761 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 2219661..2219761 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 2219661..2219761 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 2222100..2222294 (195 bp)
Type: Others
Protein ID: WP_004399291.1
Type: Others
Protein ID: WP_004399291.1
Location: 2214732..2214959 (228 bp)
Type: Others
Protein ID: WP_004399298.1
Type: Others
Protein ID: WP_004399298.1
Location: 2215220..2216536 (1317 bp)
Type: Others
Protein ID: WP_004399369.1
Type: Others
Protein ID: WP_004399369.1
Location: 2216893..2217399 (507 bp)
Type: Others
Protein ID: WP_004399486.1
Type: Others
Protein ID: WP_004399486.1
Location: 2217727..2218959 (1233 bp)
Type: Others
Protein ID: WP_004399445.1
Type: Others
Protein ID: WP_004399445.1
Location: 2219041..2219229 (189 bp)
Type: Others
Protein ID: WP_004399547.1
Type: Others
Protein ID: WP_004399547.1
Location: 2219274..2219525 (252 bp)
Type: Others
Protein ID: WP_010886546.1
Type: Others
Protein ID: WP_010886546.1
Location: 2219544..2219720 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1
Type: Toxin
Protein ID: WP_009967515.1
Location: 2220095..2220706 (612 bp)
Type: Others
Protein ID: WP_009967516.1
Type: Others
Protein ID: WP_009967516.1
Location: 2220821..2221147 (327 bp)
Type: Others
Protein ID: WP_009967517.1
Type: Others
Protein ID: WP_009967517.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QX56_RS10955 | 2214732..2214959 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
QX56_RS10960 | 2215220..2216536 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
QX56_RS10965 | 2216893..2217399 | - | 507 | WP_004399486.1 | hypothetical protein | - |
QX56_RS10970 | 2217727..2218959 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
QX56_RS10975 | 2219041..2219229 | - | 189 | WP_004399547.1 | hypothetical protein | - |
QX56_RS21765 | 2219274..2219525 | - | 252 | WP_010886546.1 | hypothetical protein | - |
QX56_RS21770 | 2219544..2219720 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- | 2219661..2219761 | + | 101 | NuclAT_2 | - | Antitoxin |
- | 2219661..2219761 | + | 101 | NuclAT_2 | - | Antitoxin |
- | 2219661..2219761 | + | 101 | NuclAT_2 | - | Antitoxin |
- | 2219661..2219761 | + | 101 | NuclAT_2 | - | Antitoxin |
QX56_RS10980 | 2220095..2220706 | - | 612 | WP_009967516.1 | lipoprotein | - |
QX56_RS10985 | 2220821..2221147 | - | 327 | WP_009967517.1 | helix-turn-helix domain-containing protein | - |
QX56_RS10990 | 2222100..2222294 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2151386..2286168 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T50311 WP_009967515.1 NZ_CP010053:c2219720-2219544 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
>T50311 NZ_CP010053:c2219720-2219544 [Bacillus subtilis]
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
Antitoxin
Download Length: 101 bp
>AT50311 NZ_CP010053:2219661-2219761 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | O31941 |
Antitoxin
Download structure file