Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 2265105..2265322 | Replicon | chromosome |
Accession | NZ_OX419569 | ||
Organism | Bacillus subtilis isolate NRS6118 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | KJP55_RS11715 | Protein ID | WP_009967515.1 |
Coordinates | 2265105..2265281 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 2265222..2265322 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP55_RS11685 (2260293) | 2260293..2260520 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
KJP55_RS11690 (2260781) | 2260781..2262097 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
KJP55_RS11695 (2262454) | 2262454..2262960 | - | 507 | WP_004399486.1 | hypothetical protein | - |
KJP55_RS11700 (2263288) | 2263288..2264520 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
KJP55_RS11705 (2264602) | 2264602..2264790 | - | 189 | WP_004399547.1 | hypothetical protein | - |
KJP55_RS11710 (2264835) | 2264835..2265086 | - | 252 | WP_010886546.1 | hypothetical protein | - |
KJP55_RS11715 (2265105) | 2265105..2265281 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- (2265222) | 2265222..2265322 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2265222) | 2265222..2265322 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2265222) | 2265222..2265322 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2265222) | 2265222..2265322 | + | 101 | NuclAT_2 | - | Antitoxin |
KJP55_RS11720 (2265656) | 2265656..2266267 | - | 612 | WP_009967516.1 | lipoprotein | - |
KJP55_RS11725 (2266382) | 2266382..2266708 | - | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
KJP55_RS11730 (2267661) | 2267661..2267855 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2195159..2345976 | 150817 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T296853 WP_009967515.1 NZ_OX419569:c2265281-2265105 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT296853 NZ_OX419569:2265222-2265322 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|