Detailed information of TA system TA039068

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): bsrG-as-bsrH/-
• Location: 2239690..2239980
• Replicon: chromosome
• Accession: NZ_AP024625
• Organism: Bacillus subtilis strain BEST3109

Toxin (Protein)

• Gene name: bsrG
• Uniprot ID: L8EAY0
• Locus tag: BsBEST3145_RS11510
• Protein ID: WP_009967548.1
• Coordinates: 2239690..2239806 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	as-bsrH
Locus tag	-
Coordinates	2239801..2239980 (-)

Genomic Context

Location: 2238252..2238587 (336 bp)
Type: Others
Protein ID: WP_004399073.1

Location: 2239690..2239806 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1

Location: 2244309..2244443 (135 bp)
Type: Others
Protein ID: WP_234047931.1

Location: 2235617..2235787 (171 bp)
Type: Others
Protein ID: WP_009967544.1

Location: 2236084..2236401 (318 bp)
Type: Others
Protein ID: WP_009967545.1

Location: 2236503..2237753 (1251 bp)
Type: Others
Protein ID: WP_004398504.1

Location: 2237746..2238078 (333 bp)
Type: Others
Protein ID: WP_004398710.1

Location: 2238630..2238986 (357 bp)
Type: Others
Protein ID: WP_004398595.1

Location: 2238992..2239459 (468 bp)
Type: Others
Protein ID: WP_003246138.1

Location: 2239801..2239980 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2239801..2239980 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2239801..2239980 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2239801..2239980 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2240085..2240618 (534 bp)
Type: Others
Protein ID: WP_004399156.1

Location: 2240654..2241232 (579 bp)
Type: Others
Protein ID: WP_004399123.1

Location: 2241296..2241793 (498 bp)
Type: Others
Protein ID: WP_003246188.1

Location: 2241802..2243517 (1716 bp)
Type: Others
Protein ID: WP_004398855.1

Location: 2243617..2244174 (558 bp)
Type: Others
Protein ID: WP_003246042.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BsBEST3145_RS11475 (2235617)	2235617..2235787	-	171	WP_009967544.1	bacteriocin sublancin-168	-
BsBEST3145_RS11480 (2236084)	2236084..2236401	-	318	WP_009967545.1	sublancin immunity protein SunI	-
BsBEST3145_RS11485 (2236503)	2236503..2237753	-	1251	WP_004398504.1	UV-damage repair protein uvrX	-
BsBEST3145_RS11490 (2237746)	2237746..2238078	-	333	WP_004398710.1	YolD-like family protein	-
BsBEST3145_RS11495 (2238252)	2238252..2238587	+	336	WP_004399073.1	hypothetical protein	-
BsBEST3145_RS11500 (2238630)	2238630..2238986	-	357	WP_004398595.1	hypothetical protein	-
BsBEST3145_RS11505 (2238992)	2238992..2239459	-	468	WP_003246138.1	YolA family protein	-
BsBEST3145_RS11510 (2239690)	2239690..2239806	+	117	WP_009967548.1	type I toxin-antitoxin system toxin BsrG	Toxin
- (2239801)	2239801..2239980	-	180	NuclAT_1	-	Antitoxin
- (2239801)	2239801..2239980	-	180	NuclAT_1	-	Antitoxin
- (2239801)	2239801..2239980	-	180	NuclAT_1	-	Antitoxin
- (2239801)	2239801..2239980	-	180	NuclAT_1	-	Antitoxin
BsBEST3145_RS11515 (2240085)	2240085..2240618	-	534	WP_004399156.1	GNAT family protein	-
BsBEST3145_RS11520 (2240654)	2240654..2241232	-	579	WP_004399123.1	SMI1/KNR4 family protein	-
BsBEST3145_RS11525 (2241296)	2241296..2241793	-	498	WP_003246188.1	SMI1/KNR4 family protein	-
BsBEST3145_RS11530 (2241802)	2241802..2243517	-	1716	WP_004398855.1	ribonuclease YeeF family protein	-
BsBEST3145_RS11535 (2243617)	2243617..2244174	-	558	WP_003246042.1	SMI1/KNR4 family protein	-
BsBEST3145_RS11540 (2244309)	2244309..2244443	+	135	WP_234047931.1	transposase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0.003	inside	Prophage	-	-	2117724..2266751	149027

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-38)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4336.39 Da
• Isoelectric Point: 10.1022

>T39068 WP_009967548.1 NZ_AP024625:2239690-2239806 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Nucleotide

• Length: 117 bp

>T39068 NZ_AP024625:2239690-2239806 [Bacillus subtilis]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG

Antitoxin

Nucleotide

• Length: 180 bp

>AT39068 NZ_AP024625:c2239980-2239801 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A7Z7EVU9

Antitoxin