Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 2219424..2219641 | Replicon | chromosome |
Accession | NZ_CP103066 | ||
Organism | Bacillus subtilis strain 0137 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | NXS96_RS11460 | Protein ID | WP_009967515.1 |
Coordinates | 2219424..2219600 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 2219541..2219641 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NXS96_RS11430 (2214611) | 2214611..2214838 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
NXS96_RS11435 (2215099) | 2215099..2216415 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
NXS96_RS11440 (2216772) | 2216772..2217278 | - | 507 | WP_004399486.1 | hypothetical protein | - |
NXS96_RS11445 (2217607) | 2217607..2218839 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
NXS96_RS11450 (2218921) | 2218921..2219109 | - | 189 | WP_004399547.1 | hypothetical protein | - |
NXS96_RS11455 (2219154) | 2219154..2219405 | - | 252 | WP_010886546.1 | hypothetical protein | - |
NXS96_RS11460 (2219424) | 2219424..2219600 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- (2219541) | 2219541..2219641 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2219541) | 2219541..2219641 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2219541) | 2219541..2219641 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2219541) | 2219541..2219641 | + | 101 | NuclAT_2 | - | Antitoxin |
NXS96_RS11465 (2219975) | 2219975..2220586 | - | 612 | WP_009967516.1 | lipoprotein | - |
NXS96_RS11470 (2220701) | 2220701..2221027 | - | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
NXS96_RS11475 (2221980) | 2221980..2222174 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2151265..2286041 | 134776 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T254837 WP_009967515.1 NZ_CP103066:c2219600-2219424 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT254837 NZ_CP103066:2219541-2219641 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|