Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2392247..2392464 | Replicon | chromosome |
Accession | NZ_CP015375 | ||
Organism | Bacillus subtilis subsp. subtilis strain KCTC 3135 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | AS891_RS12705 | Protein ID | WP_009967515.1 |
Coordinates | 2392247..2392423 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2392364..2392464 (-) |
Genomic Context
Location: 2390820..2391146 (327 bp)
Type: Others
Protein ID: WP_009967517.1
Type: Others
Protein ID: WP_009967517.1
Location: 2391261..2391872 (612 bp)
Type: Others
Protein ID: WP_009967516.1
Type: Others
Protein ID: WP_009967516.1
Location: 2392247..2392423 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1
Type: Toxin
Protein ID: WP_009967515.1
Location: 2392442..2392693 (252 bp)
Type: Others
Protein ID: WP_010886546.1
Type: Others
Protein ID: WP_010886546.1
Location: 2392738..2392926 (189 bp)
Type: Others
Protein ID: WP_004399547.1
Type: Others
Protein ID: WP_004399547.1
Location: 2393008..2394240 (1233 bp)
Type: Others
Protein ID: WP_004399445.1
Type: Others
Protein ID: WP_004399445.1
Location: 2394568..2395074 (507 bp)
Type: Others
Protein ID: WP_004399486.1
Type: Others
Protein ID: WP_004399486.1
Location: 2395431..2396747 (1317 bp)
Type: Others
Protein ID: WP_004399369.1
Type: Others
Protein ID: WP_004399369.1
Location: 2397008..2397235 (228 bp)
Type: Others
Protein ID: WP_004399298.1
Type: Others
Protein ID: WP_004399298.1
Location: 2389673..2389867 (195 bp)
Type: Others
Protein ID: WP_004399291.1
Type: Others
Protein ID: WP_004399291.1
Location: 2392206..2392306 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2392206..2392306 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2392206..2392306 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2392206..2392306 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2392364..2392464 (101 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AS891_RS12690 | 2389673..2389867 | - | 195 | WP_004399291.1 | hypothetical protein | - |
AS891_RS12695 | 2390820..2391146 | + | 327 | WP_009967517.1 | helix-turn-helix domain-containing protein | - |
AS891_RS12700 | 2391261..2391872 | + | 612 | WP_009967516.1 | lipoprotein | - |
- | 2392206..2392306 | - | 101 | NuclAT_2 | - | - |
- | 2392206..2392306 | - | 101 | NuclAT_2 | - | - |
- | 2392206..2392306 | - | 101 | NuclAT_2 | - | - |
- | 2392206..2392306 | - | 101 | NuclAT_2 | - | - |
AS891_RS12705 | 2392247..2392423 | + | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- | 2392364..2392464 | - | 101 | - | - | Antitoxin |
AS891_RS22505 | 2392442..2392693 | + | 252 | WP_010886546.1 | hypothetical protein | - |
AS891_RS12710 | 2392738..2392926 | + | 189 | WP_004399547.1 | hypothetical protein | - |
AS891_RS12715 | 2393008..2394240 | + | 1233 | WP_004399445.1 | hypothetical protein | - |
AS891_RS12720 | 2394568..2395074 | + | 507 | WP_004399486.1 | hypothetical protein | - |
AS891_RS12725 | 2395431..2396747 | + | 1317 | WP_004399369.1 | hypothetical protein | - |
AS891_RS12730 | 2397008..2397235 | + | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2325154..2460581 | 135427 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T62926 WP_009967515.1 NZ_CP015375:2392247-2392423 [Bacillus subtilis subsp. subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
>T62926 NZ_CP015375:2392247-2392423 [Bacillus subtilis subsp. subtilis]
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
Antitoxin
Download Length: 101 bp
>AT62926 NZ_CP015375:c2392464-2392364 [Bacillus subtilis subsp. subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | O31941 |
Antitoxin
Download structure file