Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 2219395..2219612 | Replicon | chromosome |
Accession | NZ_CP125660 | ||
Organism | Bacillus subtilis strain GUCC48 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | QLH41_RS11445 | Protein ID | WP_009967515.1 |
Coordinates | 2219395..2219571 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 2219512..2219612 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLH41_RS11415 (2214583) | 2214583..2214810 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
QLH41_RS11420 (2215071) | 2215071..2216387 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
QLH41_RS11425 (2216744) | 2216744..2217250 | - | 507 | WP_004399486.1 | hypothetical protein | - |
QLH41_RS11430 (2217578) | 2217578..2218810 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
QLH41_RS11435 (2218892) | 2218892..2219080 | - | 189 | WP_004399547.1 | hypothetical protein | - |
QLH41_RS11440 (2219125) | 2219125..2219376 | - | 252 | WP_010886546.1 | hypothetical protein | - |
QLH41_RS11445 (2219395) | 2219395..2219571 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- (2219512) | 2219512..2219612 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2219512) | 2219512..2219612 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2219512) | 2219512..2219612 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2219512) | 2219512..2219612 | + | 101 | NuclAT_2 | - | Antitoxin |
QLH41_RS11450 (2219946) | 2219946..2220557 | - | 612 | WP_009967516.1 | lipoprotein | - |
QLH41_RS11455 (2220672) | 2220672..2220998 | - | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
QLH41_RS11460 (2221951) | 2221951..2222145 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2151237..2286019 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T282258 WP_009967515.1 NZ_CP125660:c2219571-2219395 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT282258 NZ_CP125660:2219512-2219612 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|