Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) bsrG-as-bsrH/-
Location 2291606..2291896 Replicon chromosome
Accession NZ_LN680001
Organism Bacillus subtilis strain BS34A

Toxin (Protein)


Gene name bsrG Uniprot ID L8EAY0
Locus tag VV28_RS22435 Protein ID WP_009967548.1
Coordinates 2291606..2291722 (+) Length 39 a.a.

Antitoxin (RNA)


Gene name as-bsrH
Locus tag -
Coordinates 2291717..2291896 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VV28_RS11260 2287533..2287703 - 171 WP_009967544.1 bacteriocin sublancin-168 -
VV28_RS11265 2288000..2288317 - 318 WP_009967545.1 sublancin immunity protein SunI -
VV28_RS11270 2288419..2289669 - 1251 WP_004398504.1 UV-damage repair protein uvrX -
VV28_RS11275 2289662..2289994 - 333 WP_004398710.1 YolD-like family protein -
VV28_RS11280 2290168..2290503 + 336 WP_004399073.1 hypothetical protein -
VV28_RS11285 2290546..2290902 - 357 WP_004398595.1 hypothetical protein -
VV28_RS11290 2290908..2291375 - 468 WP_003246138.1 YolA family protein -
VV28_RS22435 2291606..2291722 + 117 WP_009967548.1 type I toxin-antitoxin system toxin BsrG Toxin
- 2291717..2291896 - 180 NuclAT_1 - Antitoxin
- 2291717..2291896 - 180 NuclAT_1 - Antitoxin
- 2291717..2291896 - 180 NuclAT_1 - Antitoxin
- 2291717..2291896 - 180 NuclAT_1 - Antitoxin
VV28_RS11295 2292001..2292534 - 534 WP_004399156.1 GNAT family N-acetyltransferase -
VV28_RS11300 2292570..2293148 - 579 WP_004399123.1 SMI1/KNR4 family protein -
VV28_RS11305 2293212..2293709 - 498 WP_003246188.1 SMI1/KNR4 family protein -
VV28_RS11310 2293718..2295433 - 1716 WP_004398855.1 ribonuclease YeeF family protein -
VV28_RS11315 2295533..2296090 - 558 WP_003246042.1 SMI1/KNR4 family protein -
VV28_RS21760 2296174..2296359 + 186 WP_003245951.1 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2169640..2305065 135425
inside Prophage - - 2169640..2304420 134780


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Small toxic protein BsrE-like

(1-38)


Sequences

Toxin        


Download         Length: 39 a.a.        Molecular weight: 4336.39 Da        Isoelectric Point: 10.1022

>T285534 WP_009967548.1 NZ_LN680001:2291606-2291722 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Download         Length: 117 bp

Antitoxin


Download         Length: 180 bp

>AT285534 NZ_LN680001:c2291896-2291717 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Z7EVU9

Antitoxin

Download structure file

References