Detailed information of TA system TA039087

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): yonT-as-bsrG/-
• Location: 2185618..2185835
• Replicon: chromosome
• Accession: NZ_AP024626
• Organism: Bacillus subtilis strain BEST3125

Toxin (Protein)

• Gene name: yonT
• Uniprot ID: O31941
• Locus tag: K6K02_RS11195
• Protein ID: WP_009967515.1
• Coordinates: 2185618..2185794 (-)
• Length: 59 a.a.

Antitoxin (RNA)

Gene name	as-bsrG
Locus tag	-
Coordinates	2185735..2185835 (+)

Genomic Context

Location: 2185735..2185835 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2185735..2185835 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2185735..2185835 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2185735..2185835 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2188174..2188368 (195 bp)
Type: Others
Protein ID: WP_004399291.1

Location: 2180806..2181033 (228 bp)
Type: Others
Protein ID: WP_004399298.1

Location: 2181294..2182610 (1317 bp)
Type: Others
Protein ID: WP_004399369.1

Location: 2182967..2183473 (507 bp)
Type: Others
Protein ID: WP_004399486.1

Location: 2183801..2185033 (1233 bp)
Type: Others
Protein ID: WP_004399445.1

Location: 2185115..2185303 (189 bp)
Type: Others
Protein ID: WP_004399547.1

Location: 2185348..2185599 (252 bp)
Type: Others
Protein ID: WP_010886546.1

Location: 2185618..2185794 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1

Location: 2186169..2186780 (612 bp)
Type: Others
Protein ID: WP_009967516.1

Location: 2186895..2187221 (327 bp)
Type: Others
Protein ID: WP_009967517.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
K6K02_RS11165 (2180806)	2180806..2181033	-	228	WP_004399298.1	helix-turn-helix transcriptional regulator	-
K6K02_RS11170 (2181294)	2181294..2182610	-	1317	WP_004399369.1	hypothetical protein	-
K6K02_RS11175 (2182967)	2182967..2183473	-	507	WP_004399486.1	hypothetical protein	-
K6K02_RS11180 (2183801)	2183801..2185033	-	1233	WP_004399445.1	hypothetical protein	-
K6K02_RS11185 (2185115)	2185115..2185303	-	189	WP_004399547.1	hypothetical protein	-
K6K02_RS11190 (2185348)	2185348..2185599	-	252	WP_010886546.1	hypothetical protein	-
K6K02_RS11195 (2185618)	2185618..2185794	-	177	WP_009967515.1	hypothetical protein	Toxin
- (2185735)	2185735..2185835	+	101	NuclAT_2	-	Antitoxin
- (2185735)	2185735..2185835	+	101	NuclAT_2	-	Antitoxin
- (2185735)	2185735..2185835	+	101	NuclAT_2	-	Antitoxin
- (2185735)	2185735..2185835	+	101	NuclAT_2	-	Antitoxin
K6K02_RS11200 (2186169)	2186169..2186780	-	612	WP_009967516.1	lipoprotein	-
K6K02_RS11205 (2186895)	2186895..2187221	-	327	WP_009967517.1	helix-turn-helix transcriptional regulator	-
K6K02_RS11210 (2188174)	2188174..2188368	+	195	WP_004399291.1	hypothetical protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0.003	inside	Prophage	-	-	2117462..2266489	149027

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Sequences

Toxin

Protein

• Length: 59 a.a.
• Molecular weight: 6882.45 Da
• Isoelectric Point: 12.8833

>T39087 WP_009967515.1 NZ_AP024626:c2185794-2185618 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR

Nucleotide

• Length: 177 bp

>T39087 NZ_AP024626:c2185794-2185618 [Bacillus subtilis]
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA

Antitoxin

Nucleotide

• Length: 101 bp

>AT39087 NZ_AP024626:2185735-2185835 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: O31941

Antitoxin