Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 2219816..2220033 | Replicon | chromosome |
Accession | NZ_CP020102 | ||
Organism | Bacillus subtilis strain NCIB 3610 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | B4U62_RS11430 | Protein ID | WP_009967515.1 |
Coordinates | 2219816..2219992 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 2219933..2220033 (+) |
Genomic Context
Location: 2219933..2220033 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 2219933..2220033 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 2219933..2220033 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 2219933..2220033 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 2222372..2222566 (195 bp)
Type: Others
Protein ID: WP_004399291.1
Type: Others
Protein ID: WP_004399291.1
Location: 2215004..2215231 (228 bp)
Type: Others
Protein ID: WP_004399298.1
Type: Others
Protein ID: WP_004399298.1
Location: 2215492..2216808 (1317 bp)
Type: Others
Protein ID: WP_004399369.1
Type: Others
Protein ID: WP_004399369.1
Location: 2217165..2217671 (507 bp)
Type: Others
Protein ID: WP_004399486.1
Type: Others
Protein ID: WP_004399486.1
Location: 2217999..2219231 (1233 bp)
Type: Others
Protein ID: WP_004399445.1
Type: Others
Protein ID: WP_004399445.1
Location: 2219313..2219501 (189 bp)
Type: Others
Protein ID: WP_004399547.1
Type: Others
Protein ID: WP_004399547.1
Location: 2219546..2219797 (252 bp)
Type: Others
Protein ID: WP_010886546.1
Type: Others
Protein ID: WP_010886546.1
Location: 2219816..2219992 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1
Type: Toxin
Protein ID: WP_009967515.1
Location: 2220367..2220978 (612 bp)
Type: Others
Protein ID: WP_009967516.1
Type: Others
Protein ID: WP_009967516.1
Location: 2221093..2221419 (327 bp)
Type: Others
Protein ID: WP_009967517.1
Type: Others
Protein ID: WP_009967517.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B4U62_RS11400 | 2215004..2215231 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
B4U62_RS11405 | 2215492..2216808 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
B4U62_RS11410 | 2217165..2217671 | - | 507 | WP_004399486.1 | hypothetical protein | - |
B4U62_RS11415 | 2217999..2219231 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
B4U62_RS11420 | 2219313..2219501 | - | 189 | WP_004399547.1 | hypothetical protein | - |
B4U62_RS11425 | 2219546..2219797 | - | 252 | WP_010886546.1 | hypothetical protein | - |
B4U62_RS11430 | 2219816..2219992 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- | 2219933..2220033 | + | 101 | NuclAT_2 | - | Antitoxin |
- | 2219933..2220033 | + | 101 | NuclAT_2 | - | Antitoxin |
- | 2219933..2220033 | + | 101 | NuclAT_2 | - | Antitoxin |
- | 2219933..2220033 | + | 101 | NuclAT_2 | - | Antitoxin |
B4U62_RS11435 | 2220367..2220978 | - | 612 | WP_009967516.1 | lipoprotein | - |
B4U62_RS11440 | 2221093..2221419 | - | 327 | WP_009967517.1 | helix-turn-helix domain-containing protein | - |
B4U62_RS11445 | 2222372..2222566 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2151659..2286440 | 134781 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T74086 WP_009967515.1 NZ_CP020102:c2219992-2219816 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
>T74086 NZ_CP020102:c2219992-2219816 [Bacillus subtilis]
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
Antitoxin
Download Length: 101 bp
>AT74086 NZ_CP020102:2219933-2220033 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | O31941 |
Antitoxin
Download structure file