Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | bsrG-as-bsrH/- |
| Location | 2273053..2273343 | Replicon | chromosome |
| Accession | NZ_CP103783 | ||
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
Toxin (Protein)
| Gene name | bsrG | Uniprot ID | L8EAY0 |
| Locus tag | NYR92_RS11745 | Protein ID | WP_009967548.1 |
| Coordinates | 2273053..2273169 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrH | ||
| Locus tag | - | ||
| Coordinates | 2273164..2273343 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR92_RS11710 (2268980) | 2268980..2269150 | - | 171 | WP_009967544.1 | bacteriocin sublancin-168 | - |
| NYR92_RS11715 (2269447) | 2269447..2269764 | - | 318 | WP_009967545.1 | sublancin immunity protein SunI | - |
| NYR92_RS11720 (2269866) | 2269866..2271116 | - | 1251 | WP_004398504.1 | UV-damage repair protein uvrX | - |
| NYR92_RS11725 (2271109) | 2271109..2271441 | - | 333 | WP_004398710.1 | YolD-like family protein | - |
| NYR92_RS11730 (2271615) | 2271615..2271950 | + | 336 | WP_004399073.1 | hypothetical protein | - |
| NYR92_RS11735 (2271993) | 2271993..2272349 | - | 357 | WP_004398595.1 | hypothetical protein | - |
| NYR92_RS11740 (2272355) | 2272355..2272822 | - | 468 | WP_003246138.1 | YolA family protein | - |
| NYR92_RS11745 (2273053) | 2273053..2273169 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
| - (2273164) | 2273164..2273343 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2273164) | 2273164..2273343 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2273164) | 2273164..2273343 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2273164) | 2273164..2273343 | - | 180 | NuclAT_1 | - | Antitoxin |
| NYR92_RS11750 (2273448) | 2273448..2273981 | - | 534 | WP_004399156.1 | GNAT family protein | - |
| NYR92_RS11755 (2274017) | 2274017..2274595 | - | 579 | WP_004399123.1 | SMI1/KNR4 family protein | - |
| NYR92_RS11760 (2274659) | 2274659..2275156 | - | 498 | WP_003246188.1 | SMI1/KNR4 family protein | - |
| NYR92_RS11765 (2275165) | 2275165..2276880 | - | 1716 | WP_004398855.1 | ribonuclease YeeF family protein | - |
| NYR92_RS11770 (2276980) | 2276980..2277537 | - | 558 | WP_003246042.1 | SMI1/KNR4 family protein | - |
| NYR92_RS11775 (2277672) | 2277672..2277806 | + | 135 | WP_234047931.1 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2151085..2311344 | 160259 | ||
| inside | Prophage | - | - | 2151085..2285867 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T256656 WP_009967548.1 NZ_CP103783:2273053-2273169 [Bacillus subtilis subsp. subtilis str. 168]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
Antitoxin
Download Length: 180 bp
>AT256656 NZ_CP103783:c2273343-2273164 [Bacillus subtilis subsp. subtilis str. 168]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
