Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2219335..2219552 | Replicon | chromosome |
Accession | NZ_CP045922 | ||
Organism | Bacillus subtilis strain P8_B1 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | GII87_RS11420 | Protein ID | WP_009967515.1 |
Coordinates | 2219376..2219552 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2219335..2219435 (+) |
Genomic Context
Location: 2219335..2219435 (101 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 2219493..2219593 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2219493..2219593 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2219493..2219593 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2219493..2219593 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2221932..2222126 (195 bp)
Type: Others
Protein ID: WP_004399291.1
Type: Others
Protein ID: WP_004399291.1
Location: 2214564..2214791 (228 bp)
Type: Others
Protein ID: WP_004399298.1
Type: Others
Protein ID: WP_004399298.1
Location: 2215052..2216368 (1317 bp)
Type: Others
Protein ID: WP_004399369.1
Type: Others
Protein ID: WP_004399369.1
Location: 2216725..2217231 (507 bp)
Type: Others
Protein ID: WP_004399486.1
Type: Others
Protein ID: WP_004399486.1
Location: 2217559..2218791 (1233 bp)
Type: Others
Protein ID: WP_004399445.1
Type: Others
Protein ID: WP_004399445.1
Location: 2218873..2219061 (189 bp)
Type: Others
Protein ID: WP_004399547.1
Type: Others
Protein ID: WP_004399547.1
Location: 2219106..2219357 (252 bp)
Type: Others
Protein ID: WP_010886546.1
Type: Others
Protein ID: WP_010886546.1
Location: 2219376..2219552 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1
Type: Toxin
Protein ID: WP_009967515.1
Location: 2219927..2220538 (612 bp)
Type: Others
Protein ID: WP_009967516.1
Type: Others
Protein ID: WP_009967516.1
Location: 2220653..2220979 (327 bp)
Type: Others
Protein ID: WP_009967517.1
Type: Others
Protein ID: WP_009967517.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GII87_RS11390 | 2214564..2214791 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
GII87_RS11395 | 2215052..2216368 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
GII87_RS11400 | 2216725..2217231 | - | 507 | WP_004399486.1 | hypothetical protein | - |
GII87_RS11405 | 2217559..2218791 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
GII87_RS11410 | 2218873..2219061 | - | 189 | WP_004399547.1 | hypothetical protein | - |
GII87_RS11415 | 2219106..2219357 | - | 252 | WP_010886546.1 | hypothetical protein | - |
- | 2219335..2219435 | + | 101 | - | - | Antitoxin |
GII87_RS11420 | 2219376..2219552 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- | 2219493..2219593 | + | 101 | NuclAT_2 | - | - |
- | 2219493..2219593 | + | 101 | NuclAT_2 | - | - |
- | 2219493..2219593 | + | 101 | NuclAT_2 | - | - |
- | 2219493..2219593 | + | 101 | NuclAT_2 | - | - |
GII87_RS11425 | 2219927..2220538 | - | 612 | WP_009967516.1 | lipoprotein | - |
GII87_RS11430 | 2220653..2220979 | - | 327 | WP_009967517.1 | helix-turn-helix domain-containing protein | - |
GII87_RS11435 | 2221932..2222126 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2151218..2286000 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T143010 WP_009967515.1 NZ_CP045922:c2219552-2219376 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
>T143010 NZ_CP060924:2676280-2676387 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 101 bp
>AT143010 NZ_CP045922:2219335-2219435 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | O31941 |
Antitoxin
Download structure file