Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) bsrG-as-bsrH/-
Location 2024554..2024844 Replicon chromosome
Accession NZ_CP125762
Organism Bacillus subtilis strain KRS015

Toxin (Protein)


Gene name bsrG Uniprot ID L8EAY0
Locus tag QLQ05_RS10905 Protein ID WP_009967548.1
Coordinates 2024728..2024844 (-) Length 39 a.a.

Antitoxin (RNA)


Gene name as-bsrH
Locus tag -
Coordinates 2024554..2024733 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ05_RS10875 (2020091) 2020091..2020225 - 135 WP_234047931.1 transposase -
QLQ05_RS10880 (2020360) 2020360..2020917 + 558 WP_003246042.1 SMI1/KNR4 family protein -
QLQ05_RS10885 (2021017) 2021017..2022732 + 1716 WP_004398855.1 ribonuclease YeeF family protein -
QLQ05_RS10890 (2022741) 2022741..2023238 + 498 WP_003246188.1 SMI1/KNR4 family protein -
QLQ05_RS10895 (2023302) 2023302..2023880 + 579 WP_004399123.1 SMI1/KNR4 family protein -
QLQ05_RS10900 (2023916) 2023916..2024449 + 534 WP_004399156.1 GNAT family protein -
- (2024554) 2024554..2024733 + 180 NuclAT_2 - Antitoxin
- (2024554) 2024554..2024733 + 180 NuclAT_2 - Antitoxin
- (2024554) 2024554..2024733 + 180 NuclAT_2 - Antitoxin
- (2024554) 2024554..2024733 + 180 NuclAT_2 - Antitoxin
QLQ05_RS10905 (2024728) 2024728..2024844 - 117 WP_009967548.1 type I toxin-antitoxin system toxin BsrG Toxin
QLQ05_RS10910 (2025075) 2025075..2025542 + 468 WP_003246138.1 YolA family protein -
QLQ05_RS10915 (2025548) 2025548..2025904 + 357 WP_004398595.1 hypothetical protein -
QLQ05_RS10920 (2025947) 2025947..2026282 - 336 WP_004399073.1 hypothetical protein -
QLQ05_RS10925 (2026456) 2026456..2026788 + 333 WP_004398710.1 YolD-like family protein -
QLQ05_RS10930 (2026781) 2026781..2028031 + 1251 WP_004398504.1 UV-damage repair protein uvrX -
QLQ05_RS10935 (2028133) 2028133..2028450 + 318 WP_009967545.1 sublancin immunity protein SunI -
QLQ05_RS10940 (2028747) 2028747..2028917 + 171 WP_009967544.1 bacteriocin sublancin-168 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2012030..2280951 268921


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Small toxic protein BsrE-like

(1-38)


Sequences

Toxin        


Download         Length: 39 a.a.        Molecular weight: 4336.39 Da        Isoelectric Point: 10.1022

>T282356 WP_009967548.1 NZ_CP125762:c2024844-2024728 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Download         Length: 117 bp

Antitoxin


Download         Length: 180 bp

>AT282356 NZ_CP125762:2024554-2024733 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Z7EVU9

Antitoxin

Download structure file

References