Detailed information of TA system TA039137

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): bsrG-as-bsrH/-
• Location: 2245372..2245662
• Replicon: chromosome
• Accession: NZ_AP024628
• Organism: Bacillus subtilis strain BEST3145

Toxin (Protein)

• Gene name: bsrG
• Uniprot ID: L8EAY0
• Locus tag: K6K00_RS11475
• Protein ID: WP_009967548.1
• Coordinates: 2245372..2245488 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	as-bsrH
Locus tag	-
Coordinates	2245483..2245662 (-)

Genomic Context

Location: 2243934..2244269 (336 bp)
Type: Others
Protein ID: WP_004399073.1

Location: 2245372..2245488 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1

Location: 2249991..2250125 (135 bp)
Type: Others
Protein ID: WP_234047931.1

Location: 2241299..2241469 (171 bp)
Type: Others
Protein ID: WP_009967544.1

Location: 2241766..2242083 (318 bp)
Type: Others
Protein ID: WP_009967545.1

Location: 2242185..2243435 (1251 bp)
Type: Others
Protein ID: WP_004398504.1

Location: 2243428..2243760 (333 bp)
Type: Others
Protein ID: WP_004398710.1

Location: 2244312..2244668 (357 bp)
Type: Others
Protein ID: WP_004398595.1

Location: 2244674..2245141 (468 bp)
Type: Others
Protein ID: WP_003246138.1

Location: 2245483..2245662 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2245483..2245662 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2245483..2245662 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2245483..2245662 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2245767..2246300 (534 bp)
Type: Others
Protein ID: WP_004399156.1

Location: 2246336..2246914 (579 bp)
Type: Others
Protein ID: WP_004399123.1

Location: 2246978..2247475 (498 bp)
Type: Others
Protein ID: WP_003246188.1

Location: 2247484..2249199 (1716 bp)
Type: Others
Protein ID: WP_004398855.1

Location: 2249299..2249856 (558 bp)
Type: Others
Protein ID: WP_003246042.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
K6K00_RS11440 (2241299)	2241299..2241469	-	171	WP_009967544.1	bacteriocin sublancin-168	-
K6K00_RS11445 (2241766)	2241766..2242083	-	318	WP_009967545.1	sublancin immunity protein SunI	-
K6K00_RS11450 (2242185)	2242185..2243435	-	1251	WP_004398504.1	UV-damage repair protein uvrX	-
K6K00_RS11455 (2243428)	2243428..2243760	-	333	WP_004398710.1	YolD-like family protein	-
K6K00_RS11460 (2243934)	2243934..2244269	+	336	WP_004399073.1	hypothetical protein	-
K6K00_RS11465 (2244312)	2244312..2244668	-	357	WP_004398595.1	hypothetical protein	-
K6K00_RS11470 (2244674)	2244674..2245141	-	468	WP_003246138.1	YolA family protein	-
K6K00_RS11475 (2245372)	2245372..2245488	+	117	WP_009967548.1	type I toxin-antitoxin system toxin BsrG	Toxin
- (2245483)	2245483..2245662	-	180	NuclAT_1	-	Antitoxin
- (2245483)	2245483..2245662	-	180	NuclAT_1	-	Antitoxin
- (2245483)	2245483..2245662	-	180	NuclAT_1	-	Antitoxin
- (2245483)	2245483..2245662	-	180	NuclAT_1	-	Antitoxin
K6K00_RS11480 (2245767)	2245767..2246300	-	534	WP_004399156.1	GNAT family protein	-
K6K00_RS11485 (2246336)	2246336..2246914	-	579	WP_004399123.1	SMI1/KNR4 family protein	-
K6K00_RS11490 (2246978)	2246978..2247475	-	498	WP_003246188.1	SMI1/KNR4 family protein	-
K6K00_RS11495 (2247484)	2247484..2249199	-	1716	WP_004398855.1	ribonuclease YeeF family protein	-
K6K00_RS11500 (2249299)	2249299..2249856	-	558	WP_003246042.1	SMI1/KNR4 family protein	-
K6K00_RS11505 (2249991)	2249991..2250125	+	135	WP_234047931.1	transposase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0	inside	Prophage	-	-	2123406..2258186	134780

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-38)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4336.39 Da
• Isoelectric Point: 10.1022

>T39137 WP_009967548.1 NZ_AP024628:2245372-2245488 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Nucleotide

• Length: 117 bp

>T39137 NZ_AP024628:2245372-2245488 [Bacillus subtilis]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG

Antitoxin

Nucleotide

• Length: 180 bp

>AT39137 NZ_AP024628:c2245662-2245483 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A7Z7EVU9

Antitoxin