Detailed information of TA system TA296941

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): bsrG-as-bsrH/-
• Location: 2322127..2322417
• Replicon: chromosome
• Accession: NZ_OX419580
• Organism: Bacillus subtilis isolate NRS6116

Toxin (Protein)

• Gene name: bsrG
• Uniprot ID: L8EAY0
• Locus tag: KJP60_RS12110
• Protein ID: WP_009967548.1
• Coordinates: 2322127..2322243 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	as-bsrH
Locus tag	-
Coordinates	2322238..2322417 (-)

Genomic Context

Location: 2320689..2321024 (336 bp)
Type: Others
Protein ID: WP_004399073.1

Location: 2322127..2322243 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1

Location: 2326746..2326880 (135 bp)
Type: Others
Protein ID: WP_234047931.1

Location: 2318054..2318224 (171 bp)
Type: Others
Protein ID: WP_009967544.1

Location: 2318521..2318838 (318 bp)
Type: Others
Protein ID: WP_009967545.1

Location: 2318940..2320190 (1251 bp)
Type: Others
Protein ID: WP_004398504.1

Location: 2320183..2320515 (333 bp)
Type: Others
Protein ID: WP_004398710.1

Location: 2321067..2321423 (357 bp)
Type: Others
Protein ID: WP_004398595.1

Location: 2321429..2321896 (468 bp)
Type: Others
Protein ID: WP_003246138.1

Location: 2322238..2322417 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2322238..2322417 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2322238..2322417 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2322238..2322417 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2322522..2323055 (534 bp)
Type: Others
Protein ID: WP_004399156.1

Location: 2323091..2323669 (579 bp)
Type: Others
Protein ID: WP_004399123.1

Location: 2323733..2324230 (498 bp)
Type: Others
Protein ID: WP_003246188.1

Location: 2324239..2325954 (1716 bp)
Type: Others
Protein ID: WP_004398855.1

Location: 2326054..2326611 (558 bp)
Type: Others
Protein ID: WP_003246042.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
KJP60_RS12075 (2318054)	2318054..2318224	-	171	WP_009967544.1	bacteriocin sublancin-168	-
KJP60_RS12080 (2318521)	2318521..2318838	-	318	WP_009967545.1	sublancin immunity protein SunI	-
KJP60_RS12085 (2318940)	2318940..2320190	-	1251	WP_004398504.1	UV-damage repair protein uvrX	-
KJP60_RS12090 (2320183)	2320183..2320515	-	333	WP_004398710.1	YolD-like family protein	-
KJP60_RS12095 (2320689)	2320689..2321024	+	336	WP_004399073.1	hypothetical protein	-
KJP60_RS12100 (2321067)	2321067..2321423	-	357	WP_004398595.1	hypothetical protein	-
KJP60_RS12105 (2321429)	2321429..2321896	-	468	WP_003246138.1	YolA family protein	-
KJP60_RS12110 (2322127)	2322127..2322243	+	117	WP_009967548.1	type I toxin-antitoxin system toxin BsrG	Toxin
- (2322238)	2322238..2322417	-	180	NuclAT_1	-	Antitoxin
- (2322238)	2322238..2322417	-	180	NuclAT_1	-	Antitoxin
- (2322238)	2322238..2322417	-	180	NuclAT_1	-	Antitoxin
- (2322238)	2322238..2322417	-	180	NuclAT_1	-	Antitoxin
KJP60_RS12115 (2322522)	2322522..2323055	-	534	WP_004399156.1	GNAT family protein	-
KJP60_RS12120 (2323091)	2323091..2323669	-	579	WP_004399123.1	SMI1/KNR4 family protein	-
KJP60_RS12125 (2323733)	2323733..2324230	-	498	WP_003246188.1	SMI1/KNR4 family protein	-
KJP60_RS12130 (2324239)	2324239..2325954	-	1716	WP_004398855.1	ribonuclease YeeF family protein	-
KJP60_RS12135 (2326054)	2326054..2326611	-	558	WP_003246042.1	SMI1/KNR4 family protein	-
KJP60_RS12140 (2326746)	2326746..2326880	+	135	WP_234047931.1	transposase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0	inside	Prophage	-	-	2200159..2334941	134782

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-38)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4336.39 Da
• Isoelectric Point: 10.1022

>T296941 WP_009967548.1 NZ_OX419580:2322127-2322243 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Nucleotide

• Length: 117 bp

Antitoxin

Nucleotide

• Length: 180 bp

>AT296941 NZ_OX419580:c2322417-2322238 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A7Z7EVU9

Antitoxin