Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | bsrG-as-bsrH/- |
| Location | 2322127..2322417 | Replicon | chromosome |
| Accession | NZ_OX419580 | ||
| Organism | Bacillus subtilis isolate NRS6116 | ||
Toxin (Protein)
| Gene name | bsrG | Uniprot ID | L8EAY0 |
| Locus tag | KJP60_RS12110 | Protein ID | WP_009967548.1 |
| Coordinates | 2322127..2322243 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrH | ||
| Locus tag | - | ||
| Coordinates | 2322238..2322417 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP60_RS12075 (2318054) | 2318054..2318224 | - | 171 | WP_009967544.1 | bacteriocin sublancin-168 | - |
| KJP60_RS12080 (2318521) | 2318521..2318838 | - | 318 | WP_009967545.1 | sublancin immunity protein SunI | - |
| KJP60_RS12085 (2318940) | 2318940..2320190 | - | 1251 | WP_004398504.1 | UV-damage repair protein uvrX | - |
| KJP60_RS12090 (2320183) | 2320183..2320515 | - | 333 | WP_004398710.1 | YolD-like family protein | - |
| KJP60_RS12095 (2320689) | 2320689..2321024 | + | 336 | WP_004399073.1 | hypothetical protein | - |
| KJP60_RS12100 (2321067) | 2321067..2321423 | - | 357 | WP_004398595.1 | hypothetical protein | - |
| KJP60_RS12105 (2321429) | 2321429..2321896 | - | 468 | WP_003246138.1 | YolA family protein | - |
| KJP60_RS12110 (2322127) | 2322127..2322243 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
| - (2322238) | 2322238..2322417 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2322238) | 2322238..2322417 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2322238) | 2322238..2322417 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2322238) | 2322238..2322417 | - | 180 | NuclAT_1 | - | Antitoxin |
| KJP60_RS12115 (2322522) | 2322522..2323055 | - | 534 | WP_004399156.1 | GNAT family protein | - |
| KJP60_RS12120 (2323091) | 2323091..2323669 | - | 579 | WP_004399123.1 | SMI1/KNR4 family protein | - |
| KJP60_RS12125 (2323733) | 2323733..2324230 | - | 498 | WP_003246188.1 | SMI1/KNR4 family protein | - |
| KJP60_RS12130 (2324239) | 2324239..2325954 | - | 1716 | WP_004398855.1 | ribonuclease YeeF family protein | - |
| KJP60_RS12135 (2326054) | 2326054..2326611 | - | 558 | WP_003246042.1 | SMI1/KNR4 family protein | - |
| KJP60_RS12140 (2326746) | 2326746..2326880 | + | 135 | WP_234047931.1 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2200159..2334941 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T296941 WP_009967548.1 NZ_OX419580:2322127-2322243 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
Antitoxin
Download Length: 180 bp
>AT296941 NZ_OX419580:c2322417-2322238 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
