Detailed information of TA system TA039091

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): bsrG-as-bsrH/-
• Location: 2239428..2239718
• Replicon: chromosome
• Accession: NZ_AP024626
• Organism: Bacillus subtilis strain BEST3125

Toxin (Protein)

• Gene name: bsrG
• Uniprot ID: L8EAY0
• Locus tag: K6K02_RS11490
• Protein ID: WP_009967548.1
• Coordinates: 2239428..2239544 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	as-bsrH
Locus tag	-
Coordinates	2239539..2239718 (-)

Genomic Context

Location: 2237990..2238325 (336 bp)
Type: Others
Protein ID: WP_004399073.1

Location: 2239428..2239544 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1

Location: 2244047..2244181 (135 bp)
Type: Others
Protein ID: WP_234047931.1

Location: 2235355..2235525 (171 bp)
Type: Others
Protein ID: WP_009967544.1

Location: 2235822..2236139 (318 bp)
Type: Others
Protein ID: WP_009967545.1

Location: 2236241..2237491 (1251 bp)
Type: Others
Protein ID: WP_004398504.1

Location: 2237484..2237816 (333 bp)
Type: Others
Protein ID: WP_004398710.1

Location: 2238368..2238724 (357 bp)
Type: Others
Protein ID: WP_004398595.1

Location: 2238730..2239197 (468 bp)
Type: Others
Protein ID: WP_003246138.1

Location: 2239539..2239718 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2239539..2239718 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2239539..2239718 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2239539..2239718 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2239823..2240356 (534 bp)
Type: Others
Protein ID: WP_004399156.1

Location: 2240392..2240970 (579 bp)
Type: Others
Protein ID: WP_004399123.1

Location: 2241034..2241531 (498 bp)
Type: Others
Protein ID: WP_003246188.1

Location: 2241540..2243255 (1716 bp)
Type: Others
Protein ID: WP_004398855.1

Location: 2243355..2243912 (558 bp)
Type: Others
Protein ID: WP_003246042.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
K6K02_RS11455 (2235355)	2235355..2235525	-	171	WP_009967544.1	bacteriocin sublancin-168	-
K6K02_RS11460 (2235822)	2235822..2236139	-	318	WP_009967545.1	sublancin immunity protein SunI	-
K6K02_RS11465 (2236241)	2236241..2237491	-	1251	WP_004398504.1	UV-damage repair protein uvrX	-
K6K02_RS11470 (2237484)	2237484..2237816	-	333	WP_004398710.1	YolD-like family protein	-
K6K02_RS11475 (2237990)	2237990..2238325	+	336	WP_004399073.1	hypothetical protein	-
K6K02_RS11480 (2238368)	2238368..2238724	-	357	WP_004398595.1	hypothetical protein	-
K6K02_RS11485 (2238730)	2238730..2239197	-	468	WP_003246138.1	YolA family protein	-
K6K02_RS11490 (2239428)	2239428..2239544	+	117	WP_009967548.1	type I toxin-antitoxin system toxin BsrG	Toxin
- (2239539)	2239539..2239718	-	180	NuclAT_1	-	Antitoxin
- (2239539)	2239539..2239718	-	180	NuclAT_1	-	Antitoxin
- (2239539)	2239539..2239718	-	180	NuclAT_1	-	Antitoxin
- (2239539)	2239539..2239718	-	180	NuclAT_1	-	Antitoxin
K6K02_RS11495 (2239823)	2239823..2240356	-	534	WP_004399156.1	GNAT family protein	-
K6K02_RS11500 (2240392)	2240392..2240970	-	579	WP_004399123.1	SMI1/KNR4 family protein	-
K6K02_RS11505 (2241034)	2241034..2241531	-	498	WP_003246188.1	SMI1/KNR4 family protein	-
K6K02_RS11510 (2241540)	2241540..2243255	-	1716	WP_004398855.1	ribonuclease YeeF family protein	-
K6K02_RS11515 (2243355)	2243355..2243912	-	558	WP_003246042.1	SMI1/KNR4 family protein	-
K6K02_RS11520 (2244047)	2244047..2244181	+	135	WP_234047931.1	transposase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0.003	inside	Prophage	-	-	2117462..2266489	149027

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-38)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4336.39 Da
• Isoelectric Point: 10.1022

>T39091 WP_009967548.1 NZ_AP024626:2239428-2239544 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Nucleotide

• Length: 117 bp

>T39091 NZ_AP024626:2239428-2239544 [Bacillus subtilis]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG

Antitoxin

Nucleotide

• Length: 180 bp

>AT39091 NZ_AP024626:c2239718-2239539 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A7Z7EVU9

Antitoxin