Detailed information of TA system TA180103

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): bsrG-as-bsrH/-
• Location: 1365446..1365736
• Replicon: chromosome
• Accession: NZ_CP064096
• Organism: Bacillus subtilis strain N1142-3at

Toxin (Protein)

• Gene name: bsrG
• Uniprot ID: L8EAY0
• Locus tag: IRJ28_RS07385
• Protein ID: WP_009967548.1
• Coordinates: 1365620..1365736 (-)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	as-bsrH
Locus tag	-
Coordinates	1365446..1365625 (+)

Genomic Context

Location: 1361252..1361809 (558 bp)
Type: Others
Protein ID: WP_003246042.1

Location: 1361909..1363624 (1716 bp)
Type: Others
Protein ID: WP_004398855.1

Location: 1363633..1364130 (498 bp)
Type: Others
Protein ID: WP_003246188.1

Location: 1364194..1364772 (579 bp)
Type: Others
Protein ID: WP_004399123.1

Location: 1364808..1365341 (534 bp)
Type: Others
Protein ID: WP_004399156.1

Location: 1365446..1365625 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 1365446..1365625 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 1365446..1365625 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 1365446..1365625 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 1365967..1366434 (468 bp)
Type: Others
Protein ID: WP_003246138.1

Location: 1366440..1366796 (357 bp)
Type: Others
Protein ID: WP_004398595.1

Location: 1367348..1367680 (333 bp)
Type: Others
Protein ID: WP_004398710.1

Location: 1367673..1368923 (1251 bp)
Type: Others
Protein ID: WP_004398504.1

Location: 1369025..1369342 (318 bp)
Type: Others
Protein ID: WP_009967545.1

Location: 1369639..1369809 (171 bp)
Type: Others
Protein ID: WP_009967544.1

Location: 1360983..1361117 (135 bp)
Type: Others
Protein ID: WP_234047931.1

Location: 1365620..1365736 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1

Location: 1366839..1367174 (336 bp)
Type: Others
Protein ID: WP_004399073.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
IRJ28_RS07355 (1360983)	1360983..1361117	-	135	WP_234047931.1	transposase	-
IRJ28_RS07360 (1361252)	1361252..1361809	+	558	WP_003246042.1	SMI1/KNR4 family protein	-
IRJ28_RS07365 (1361909)	1361909..1363624	+	1716	WP_004398855.1	ribonuclease YeeF family protein	-
IRJ28_RS07370 (1363633)	1363633..1364130	+	498	WP_003246188.1	SMI1/KNR4 family protein	-
IRJ28_RS07375 (1364194)	1364194..1364772	+	579	WP_004399123.1	SMI1/KNR4 family protein	-
IRJ28_RS07380 (1364808)	1364808..1365341	+	534	WP_004399156.1	GNAT family protein	-
- (1365446)	1365446..1365625	+	180	NuclAT_1	-	Antitoxin
- (1365446)	1365446..1365625	+	180	NuclAT_1	-	Antitoxin
- (1365446)	1365446..1365625	+	180	NuclAT_1	-	Antitoxin
- (1365446)	1365446..1365625	+	180	NuclAT_1	-	Antitoxin
IRJ28_RS07385 (1365620)	1365620..1365736	-	117	WP_009967548.1	type I toxin-antitoxin system toxin BsrG	Toxin
IRJ28_RS07390 (1365967)	1365967..1366434	+	468	WP_003246138.1	YolA family protein	-
IRJ28_RS07395 (1366440)	1366440..1366796	+	357	WP_004398595.1	hypothetical protein	-
IRJ28_RS07400 (1366839)	1366839..1367174	-	336	WP_004399073.1	hypothetical protein	-
IRJ28_RS07405 (1367348)	1367348..1367680	+	333	WP_004398710.1	YolD-like family protein	-
IRJ28_RS07410 (1367673)	1367673..1368923	+	1251	WP_004398504.1	UV-damage repair protein uvrX	-
IRJ28_RS07415 (1369025)	1369025..1369342	+	318	WP_009967545.1	sublancin immunity protein SunI	-
IRJ28_RS07420 (1369639)	1369639..1369809	+	171	WP_009967544.1	bacteriocin sublancin-168	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0.004	inside	Prophage	-	-	1327445..1487704	160259

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-38)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4336.39 Da
• Isoelectric Point: 10.1022

>T180103 WP_009967548.1 NZ_CP064096:c1365736-1365620 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Nucleotide

• Length: 117 bp

>T180103 NZ_CP085063:4247120-4247527 [Escherichia coli]
GTGGTCCTGTGGCAATCTGATTTGCGCGTCTCCTGGCGCGCACAGTGGCTTTCCTTGCTGATCCACGGGCTGGTTGCCGC
TGTTATTTTACTCATGCCCTGGCCGCTCAGTTACACCCCGTTATGGATGGTGTTACTTTCGCTGGTGGTGTTTGATTGTG
TTCGCAGCCAGCGACGCATTAATGCTCGCCAGGGAGAAATTCGCCTGTTGATGGACGGGCGTTTGCGTTGGCAAGGGCAG
GAGTGGAGCATCGTCAAAGCGCCGTGGATGATTAAGAGCGGCATGATGCTGCGTTTACGTTCTGATAGCGGTAAACGGCA
ACATTTATGGCTGGCAGCCGACAGCATGGACGAAGCCGAATGGCGGGATTTACGGCGGATATTGTTGCAACAAGAGACGC
AAAGATAA

Antitoxin

Nucleotide

• Length: 180 bp

>AT180103 NZ_CP064096:1365446-1365625 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A7Z7EVU9

Antitoxin