Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | bsrG-as-bsrH/- |
Location | 2273626..2273916 | Replicon | chromosome |
Accession | NZ_CP020102 | ||
Organism | Bacillus subtilis strain NCIB 3610 |
Toxin (Protein)
Gene name | bsrG | Uniprot ID | L8EAY0 |
Locus tag | B4U62_RS22820 | Protein ID | WP_009967548.1 |
Coordinates | 2273626..2273742 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | as-bsrH | ||
Locus tag | - | ||
Coordinates | 2273737..2273916 (-) |
Genomic Context
Location: 2272188..2272523 (336 bp)
Type: Others
Protein ID: WP_004399073.1
Type: Others
Protein ID: WP_004399073.1
Location: 2273626..2273742 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1
Type: Toxin
Protein ID: WP_009967548.1
Location: 2278194..2278379 (186 bp)
Type: Others
Protein ID: WP_003245951.1
Type: Others
Protein ID: WP_003245951.1
Location: 2269553..2269723 (171 bp)
Type: Others
Protein ID: WP_009967544.1
Type: Others
Protein ID: WP_009967544.1
Location: 2270020..2270337 (318 bp)
Type: Others
Protein ID: WP_009967545.1
Type: Others
Protein ID: WP_009967545.1
Location: 2270439..2271689 (1251 bp)
Type: Others
Protein ID: WP_004398504.1
Type: Others
Protein ID: WP_004398504.1
Location: 2271682..2272014 (333 bp)
Type: Others
Protein ID: WP_004398710.1
Type: Others
Protein ID: WP_004398710.1
Location: 2272566..2272922 (357 bp)
Type: Others
Protein ID: WP_004398595.1
Type: Others
Protein ID: WP_004398595.1
Location: 2272928..2273395 (468 bp)
Type: Others
Protein ID: WP_003246138.1
Type: Others
Protein ID: WP_003246138.1
Location: 2273737..2273916 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2273737..2273916 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2273737..2273916 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2273737..2273916 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2274021..2274554 (534 bp)
Type: Others
Protein ID: WP_004399156.1
Type: Others
Protein ID: WP_004399156.1
Location: 2274590..2275168 (579 bp)
Type: Others
Protein ID: WP_004399123.1
Type: Others
Protein ID: WP_004399123.1
Location: 2275232..2275729 (498 bp)
Type: Others
Protein ID: WP_003246188.1
Type: Others
Protein ID: WP_003246188.1
Location: 2275738..2277453 (1716 bp)
Type: Others
Protein ID: WP_004398855.1
Type: Others
Protein ID: WP_004398855.1
Location: 2277553..2278110 (558 bp)
Type: Others
Protein ID: WP_003246042.1
Type: Others
Protein ID: WP_003246042.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B4U62_RS11685 | 2269553..2269723 | - | 171 | WP_009967544.1 | bacteriocin sublancin-168 | - |
B4U62_RS11690 | 2270020..2270337 | - | 318 | WP_009967545.1 | sublancin immunity protein SunI | - |
B4U62_RS11695 | 2270439..2271689 | - | 1251 | WP_004398504.1 | UV-damage repair protein uvrX | - |
B4U62_RS11700 | 2271682..2272014 | - | 333 | WP_004398710.1 | YolD-like family protein | - |
B4U62_RS11705 | 2272188..2272523 | + | 336 | WP_004399073.1 | hypothetical protein | - |
B4U62_RS11710 | 2272566..2272922 | - | 357 | WP_004398595.1 | hypothetical protein | - |
B4U62_RS11715 | 2272928..2273395 | - | 468 | WP_003246138.1 | YolA family protein | - |
B4U62_RS22820 | 2273626..2273742 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
- | 2273737..2273916 | - | 180 | NuclAT_1 | - | Antitoxin |
- | 2273737..2273916 | - | 180 | NuclAT_1 | - | Antitoxin |
- | 2273737..2273916 | - | 180 | NuclAT_1 | - | Antitoxin |
- | 2273737..2273916 | - | 180 | NuclAT_1 | - | Antitoxin |
B4U62_RS11720 | 2274021..2274554 | - | 534 | WP_004399156.1 | GNAT family N-acetyltransferase | - |
B4U62_RS11725 | 2274590..2275168 | - | 579 | WP_004399123.1 | SMI1/KNR4 family protein | - |
B4U62_RS11730 | 2275232..2275729 | - | 498 | WP_003246188.1 | SMI1/KNR4 family protein | - |
B4U62_RS11735 | 2275738..2277453 | - | 1716 | WP_004398855.1 | ribonuclease YeeF family protein | - |
B4U62_RS11740 | 2277553..2278110 | - | 558 | WP_003246042.1 | SMI1/KNR4 family protein | - |
B4U62_RS11745 | 2278194..2278379 | + | 186 | WP_003245951.1 | transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2151659..2286440 | 134781 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T74090 WP_009967548.1 NZ_CP020102:2273626-2273742 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
>T74090 NZ_CP020102:2273626-2273742 [Bacillus subtilis]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
Antitoxin
Download Length: 180 bp
>AT74090 NZ_CP020102:c2273916-2273737 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z7EVU9 |
Antitoxin
Download structure file