Detailed information of TA system TA239797

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): bsrG-as-bsrH/-
• Location: 2268818..2269108
• Replicon: chromosome
• Accession: NZ_CP094361
• Organism: Bacillus subtilis strain NCIB 3610

Toxin (Protein)

• Gene name: bsrG
• Uniprot ID: L8EAY0
• Locus tag: MQC90_RS11745
• Protein ID: WP_009967548.1
• Coordinates: 2268818..2268934 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	as-bsrH
Locus tag	-
Coordinates	2268929..2269108 (-)

Genomic Context

Location: 2267380..2267715 (336 bp)
Type: Others
Protein ID: WP_004399073.1

Location: 2268818..2268934 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1

Location: 2273437..2273571 (135 bp)
Type: Others
Protein ID: WP_234047931.1

Location: 2264745..2264915 (171 bp)
Type: Others
Protein ID: WP_009967544.1

Location: 2265212..2265529 (318 bp)
Type: Others
Protein ID: WP_009967545.1

Location: 2265631..2266881 (1251 bp)
Type: Others
Protein ID: WP_004398504.1

Location: 2266874..2267206 (333 bp)
Type: Others
Protein ID: WP_004398710.1

Location: 2267758..2268114 (357 bp)
Type: Others
Protein ID: WP_004398595.1

Location: 2268120..2268587 (468 bp)
Type: Others
Protein ID: WP_003246138.1

Location: 2268929..2269108 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2268929..2269108 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2268929..2269108 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2268929..2269108 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2269213..2269746 (534 bp)
Type: Others
Protein ID: WP_004399156.1

Location: 2269782..2270360 (579 bp)
Type: Others
Protein ID: WP_004399123.1

Location: 2270424..2270921 (498 bp)
Type: Others
Protein ID: WP_003246188.1

Location: 2270930..2272645 (1716 bp)
Type: Others
Protein ID: WP_004398855.1

Location: 2272745..2273302 (558 bp)
Type: Others
Protein ID: WP_003246042.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
MQC90_RS11710 (2264745)	2264745..2264915	-	171	WP_009967544.1	bacteriocin sublancin-168	-
MQC90_RS11715 (2265212)	2265212..2265529	-	318	WP_009967545.1	sublancin immunity protein SunI	-
MQC90_RS11720 (2265631)	2265631..2266881	-	1251	WP_004398504.1	UV-damage repair protein uvrX	-
MQC90_RS11725 (2266874)	2266874..2267206	-	333	WP_004398710.1	YolD-like family protein	-
MQC90_RS11730 (2267380)	2267380..2267715	+	336	WP_004399073.1	hypothetical protein	-
MQC90_RS11735 (2267758)	2267758..2268114	-	357	WP_004398595.1	hypothetical protein	-
MQC90_RS11740 (2268120)	2268120..2268587	-	468	WP_003246138.1	YolA family protein	-
MQC90_RS11745 (2268818)	2268818..2268934	+	117	WP_009967548.1	type I toxin-antitoxin system toxin BsrG	Toxin
- (2268929)	2268929..2269108	-	180	NuclAT_1	-	Antitoxin
- (2268929)	2268929..2269108	-	180	NuclAT_1	-	Antitoxin
- (2268929)	2268929..2269108	-	180	NuclAT_1	-	Antitoxin
- (2268929)	2268929..2269108	-	180	NuclAT_1	-	Antitoxin
MQC90_RS11750 (2269213)	2269213..2269746	-	534	WP_004399156.1	GNAT family protein	-
MQC90_RS11755 (2269782)	2269782..2270360	-	579	WP_004399123.1	SMI1/KNR4 family protein	-
MQC90_RS11760 (2270424)	2270424..2270921	-	498	WP_003246188.1	SMI1/KNR4 family protein	-
MQC90_RS11765 (2270930)	2270930..2272645	-	1716	WP_004398855.1	ribonuclease YeeF family protein	-
MQC90_RS11770 (2272745)	2272745..2273302	-	558	WP_003246042.1	SMI1/KNR4 family protein	-
MQC90_RS11775 (2273437)	2273437..2273571	+	135	WP_234047931.1	transposase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0.004	inside	Prophage	-	-	2146850..2307109	160259

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-38)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4336.39 Da
• Isoelectric Point: 10.1022

>T239797 WP_009967548.1 NZ_CP094361:2268818-2268934 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Nucleotide

• Length: 117 bp

>T239797 NZ_LS483324:c1946983-1946831 [Staphylococcus aureus]
ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACTGATTTTGAAGATTTAAAAGA
ATTAGGTAAAGAAATGGAACAAATTTCTGATCAAAATGATCAAGAAAAGAATTCTGAAGAAGACAGTCAGTAA

Antitoxin

Nucleotide

• Length: 180 bp

>AT239797 NZ_CP094361:c2269108-2268929 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A7Z7EVU9

Antitoxin