Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrE/- |
Location | 2199277..2199494 | Replicon | chromosome |
Accession | NC_018520 | ||
Organism | Bacillus subtilis QB928 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | B657_RS11435 | Protein ID | WP_009967515.1 |
Coordinates | 2199277..2199453 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrE | ||
Locus tag | - | ||
Coordinates | 2199394..2199494 (+) |
Genomic Context
Location: 2199394..2199494 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2199394..2199494 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2199394..2199494 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2199394..2199494 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2201833..2202027 (195 bp)
Type: Others
Protein ID: WP_004399291.1
Type: Others
Protein ID: WP_004399291.1
Location: 2194465..2194692 (228 bp)
Type: Others
Protein ID: WP_004399298.1
Type: Others
Protein ID: WP_004399298.1
Location: 2194953..2196269 (1317 bp)
Type: Others
Protein ID: WP_004399369.1
Type: Others
Protein ID: WP_004399369.1
Location: 2196626..2197132 (507 bp)
Type: Others
Protein ID: WP_004399486.1
Type: Others
Protein ID: WP_004399486.1
Location: 2197460..2198692 (1233 bp)
Type: Others
Protein ID: WP_004399445.1
Type: Others
Protein ID: WP_004399445.1
Location: 2198774..2198962 (189 bp)
Type: Others
Protein ID: WP_004399547.1
Type: Others
Protein ID: WP_004399547.1
Location: 2199007..2199258 (252 bp)
Type: Others
Protein ID: WP_010886546.1
Type: Others
Protein ID: WP_010886546.1
Location: 2199277..2199453 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1
Type: Toxin
Protein ID: WP_009967515.1
Location: 2199828..2200439 (612 bp)
Type: Others
Protein ID: WP_009967516.1
Type: Others
Protein ID: WP_009967516.1
Location: 2200554..2200880 (327 bp)
Type: Others
Protein ID: WP_009967517.1
Type: Others
Protein ID: WP_009967517.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B657_RS11410 | 2194465..2194692 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
B657_RS11415 | 2194953..2196269 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
B657_RS11420 | 2196626..2197132 | - | 507 | WP_004399486.1 | hypothetical protein | - |
B657_RS11425 | 2197460..2198692 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
B657_RS11430 | 2198774..2198962 | - | 189 | WP_004399547.1 | hypothetical protein | - |
B657_RS21985 | 2199007..2199258 | - | 252 | WP_010886546.1 | hypothetical protein | - |
B657_RS11435 | 2199277..2199453 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- | 2199394..2199494 | + | 101 | NuclAT_1 | - | Antitoxin |
- | 2199394..2199494 | + | 101 | NuclAT_1 | - | Antitoxin |
- | 2199394..2199494 | + | 101 | NuclAT_1 | - | Antitoxin |
- | 2199394..2199494 | + | 101 | NuclAT_1 | - | Antitoxin |
B657_RS11440 | 2199828..2200439 | - | 612 | WP_009967516.1 | lipoprotein | - |
B657_RS11445 | 2200554..2200880 | - | 327 | WP_009967517.1 | helix-turn-helix domain-containing protein | - |
B657_RS11450 | 2201833..2202027 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2131121..2265901 | 134780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T28193 WP_009967515.1 NC_018520:c2199453-2199277 [Bacillus subtilis QB928]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
>T28193 NC_018520:c2199453-2199277 [Bacillus subtilis QB928]
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
Antitoxin
Download Length: 101 bp
>AT28193 NC_018520:2199394-2199494 [Bacillus subtilis QB928]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | O31941 |
Antitoxin
Download structure file