Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 2219243..2219460 | Replicon | chromosome |
Accession | NZ_CP103783 | ||
Organism | Bacillus subtilis subsp. subtilis str. 168 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | NYR92_RS11450 | Protein ID | WP_009967515.1 |
Coordinates | 2219243..2219419 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 2219360..2219460 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR92_RS11420 (2214431) | 2214431..2214658 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
NYR92_RS11425 (2214919) | 2214919..2216235 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
NYR92_RS11430 (2216592) | 2216592..2217098 | - | 507 | WP_004399486.1 | hypothetical protein | - |
NYR92_RS11435 (2217426) | 2217426..2218658 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
NYR92_RS11440 (2218740) | 2218740..2218928 | - | 189 | WP_004399547.1 | hypothetical protein | - |
NYR92_RS11445 (2218973) | 2218973..2219224 | - | 252 | WP_010886546.1 | hypothetical protein | - |
NYR92_RS11450 (2219243) | 2219243..2219419 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- (2219360) | 2219360..2219460 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2219360) | 2219360..2219460 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2219360) | 2219360..2219460 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2219360) | 2219360..2219460 | + | 101 | NuclAT_2 | - | Antitoxin |
NYR92_RS11455 (2219794) | 2219794..2220405 | - | 612 | WP_009967516.1 | lipoprotein | - |
NYR92_RS11460 (2220520) | 2220520..2220846 | - | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
NYR92_RS11465 (2221799) | 2221799..2221993 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2151085..2311344 | 160259 | ||
inside | Prophage | - | - | 2151085..2285867 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T256652 WP_009967515.1 NZ_CP103783:c2219419-2219243 [Bacillus subtilis subsp. subtilis str. 168]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT256652 NZ_CP103783:2219360-2219460 [Bacillus subtilis subsp. subtilis str. 168]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|