Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-SR6/- |
| Location | 2936340..2936557 | Replicon | chromosome |
| Accession | NZ_CP120613 | ||
| Organism | Bacillus subtilis strain DSM 23521 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | O31941 |
| Locus tag | P5649_RS15510 | Protein ID | WP_009967515.1 |
| Coordinates | 2936340..2936516 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SR6 | ||
| Locus tag | - | ||
| Coordinates | 2936457..2936557 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5649_RS15495 | 2933767..2933961 | - | 195 | WP_004399291.1 | hypothetical protein | - |
| P5649_RS15500 | 2934913..2935239 | + | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
| P5649_RS15505 | 2935354..2935965 | + | 612 | WP_009967516.1 | lipoprotein | - |
| - | 2936299..2936399 | - | 101 | NuclAT_2 | - | - |
| - | 2936299..2936399 | - | 101 | NuclAT_2 | - | - |
| - | 2936299..2936399 | - | 101 | NuclAT_2 | - | - |
| - | 2936299..2936399 | - | 101 | NuclAT_2 | - | - |
| P5649_RS15510 | 2936340..2936516 | + | 177 | WP_009967515.1 | hypothetical protein | Toxin |
| - | 2936457..2936557 | - | 101 | - | - | Antitoxin |
| P5649_RS15515 | 2936535..2936786 | + | 252 | WP_010886546.1 | hypothetical protein | - |
| P5649_RS15520 | 2936831..2937019 | + | 189 | WP_004399547.1 | hypothetical protein | - |
| P5649_RS15525 | 2937101..2938333 | + | 1233 | WP_004399445.1 | hypothetical protein | - |
| P5649_RS15530 | 2938661..2939167 | + | 507 | WP_004399486.1 | hypothetical protein | - |
| P5649_RS15535 | 2939524..2940840 | + | 1317 | WP_004399369.1 | hypothetical protein | - |
| P5649_RS15540 | 2941101..2941328 | + | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2855647..3004673 | 149026 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T275264 WP_009967515.1 NZ_CP120613:2936340-2936516 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT275264 NZ_CP120613:c2936557-2936457 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|