Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 2221594..2221811 | Replicon | chromosome |
Accession | NZ_CP112873 | ||
Organism | Bacillus subtilis strain O4 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | ORF34_RS11470 | Protein ID | WP_009967515.1 |
Coordinates | 2221594..2221770 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 2221711..2221811 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORF34_RS11440 (2216782) | 2216782..2217009 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
ORF34_RS11445 (2217270) | 2217270..2218586 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
ORF34_RS11450 (2218943) | 2218943..2219449 | - | 507 | WP_004399486.1 | hypothetical protein | - |
ORF34_RS11455 (2219777) | 2219777..2221009 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
ORF34_RS11460 (2221091) | 2221091..2221279 | - | 189 | WP_004399547.1 | hypothetical protein | - |
ORF34_RS11465 (2221324) | 2221324..2221575 | - | 252 | WP_010886546.1 | hypothetical protein | - |
ORF34_RS11470 (2221594) | 2221594..2221770 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- (2221711) | 2221711..2221811 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2221711) | 2221711..2221811 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2221711) | 2221711..2221811 | + | 101 | NuclAT_2 | - | Antitoxin |
- (2221711) | 2221711..2221811 | + | 101 | NuclAT_2 | - | Antitoxin |
ORF34_RS11475 (2222145) | 2222145..2222756 | - | 612 | WP_009967516.1 | lipoprotein | - |
ORF34_RS11480 (2222871) | 2222871..2223197 | - | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
ORF34_RS11485 (2224150) | 2224150..2224344 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2153436..2288218 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T264908 WP_009967515.1 NZ_CP112873:c2221770-2221594 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT264908 NZ_CP112873:2221711-2221811 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|