Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2198911..2199128 | Replicon | chromosome |
Accession | NZ_AP024622 | ||
Organism | Bacillus subtilis strain BEST3096 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | K6K01_RS11270 | Protein ID | WP_009967515.1 |
Coordinates | 2198952..2199128 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2198911..2199011 (+) |
Genomic Context
Location: 2198911..2199011 (101 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 2199069..2199169 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2199069..2199169 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2199069..2199169 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2199069..2199169 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2201508..2201702 (195 bp)
Type: Others
Protein ID: WP_004399291.1
Type: Others
Protein ID: WP_004399291.1
Location: 2194140..2194367 (228 bp)
Type: Others
Protein ID: WP_004399298.1
Type: Others
Protein ID: WP_004399298.1
Location: 2194628..2195944 (1317 bp)
Type: Others
Protein ID: WP_004399369.1
Type: Others
Protein ID: WP_004399369.1
Location: 2196301..2196807 (507 bp)
Type: Others
Protein ID: WP_004399486.1
Type: Others
Protein ID: WP_004399486.1
Location: 2197135..2198367 (1233 bp)
Type: Others
Protein ID: WP_004399445.1
Type: Others
Protein ID: WP_004399445.1
Location: 2198449..2198637 (189 bp)
Type: Others
Protein ID: WP_004399547.1
Type: Others
Protein ID: WP_004399547.1
Location: 2198682..2198933 (252 bp)
Type: Others
Protein ID: WP_010886546.1
Type: Others
Protein ID: WP_010886546.1
Location: 2198952..2199128 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1
Type: Toxin
Protein ID: WP_009967515.1
Location: 2199503..2200114 (612 bp)
Type: Others
Protein ID: WP_009967516.1
Type: Others
Protein ID: WP_009967516.1
Location: 2200229..2200555 (327 bp)
Type: Others
Protein ID: WP_009967517.1
Type: Others
Protein ID: WP_009967517.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6K01_RS11240 | 2194140..2194367 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
K6K01_RS11245 | 2194628..2195944 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
K6K01_RS11250 | 2196301..2196807 | - | 507 | WP_004399486.1 | hypothetical protein | - |
K6K01_RS11255 | 2197135..2198367 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
K6K01_RS11260 | 2198449..2198637 | - | 189 | WP_004399547.1 | hypothetical protein | - |
K6K01_RS11265 | 2198682..2198933 | - | 252 | WP_010886546.1 | hypothetical protein | - |
- | 2198911..2199011 | + | 101 | - | - | Antitoxin |
K6K01_RS11270 | 2198952..2199128 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- | 2199069..2199169 | + | 101 | NuclAT_2 | - | - |
- | 2199069..2199169 | + | 101 | NuclAT_2 | - | - |
- | 2199069..2199169 | + | 101 | NuclAT_2 | - | - |
- | 2199069..2199169 | + | 101 | NuclAT_2 | - | - |
K6K01_RS11275 | 2199503..2200114 | - | 612 | WP_009967516.1 | lipoprotein | - |
K6K01_RS11280 | 2200229..2200555 | - | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
K6K01_RS11285 | 2201508..2201702 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2130796..2265576 | 134780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T38992 WP_009967515.1 NZ_AP024622:c2199128-2198952 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
>T38992 NZ_AP024622:c2199128-2198952 [Bacillus subtilis]
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
Antitoxin
Download Length: 101 bp
>AT38992 NZ_AP024622:2198911-2199011 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | O31941 |
Antitoxin
Download structure file