Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 3466108..3466325 | Replicon | chromosome |
Accession | NZ_CP064094 | ||
Organism | Bacillus subtilis strain N1108-5at |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | IRJ26_RS18440 | Protein ID | WP_009967515.1 |
Coordinates | 3466149..3466325 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 3466108..3466208 (-) |
Genomic Context
Location: 3464722..3465048 (327 bp)
Type: Others
Protein ID: WP_009967517.1
Type: Others
Protein ID: WP_009967517.1
Location: 3465163..3465774 (612 bp)
Type: Others
Protein ID: WP_009967516.1
Type: Others
Protein ID: WP_009967516.1
Location: 3466149..3466325 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1
Type: Toxin
Protein ID: WP_009967515.1
Location: 3466344..3466595 (252 bp)
Type: Others
Protein ID: WP_010886546.1
Type: Others
Protein ID: WP_010886546.1
Location: 3466640..3466828 (189 bp)
Type: Others
Protein ID: WP_004399547.1
Type: Others
Protein ID: WP_004399547.1
Location: 3466910..3468142 (1233 bp)
Type: Others
Protein ID: WP_004399445.1
Type: Others
Protein ID: WP_004399445.1
Location: 3468470..3468976 (507 bp)
Type: Others
Protein ID: WP_004399486.1
Type: Others
Protein ID: WP_004399486.1
Location: 3469333..3470649 (1317 bp)
Type: Others
Protein ID: WP_004399369.1
Type: Others
Protein ID: WP_004399369.1
Location: 3470910..3471137 (228 bp)
Type: Others
Protein ID: WP_004399298.1
Type: Others
Protein ID: WP_004399298.1
Location: 3463575..3463769 (195 bp)
Type: Others
Protein ID: WP_004399291.1
Type: Others
Protein ID: WP_004399291.1
Location: 3466108..3466208 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 3466108..3466208 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 3466108..3466208 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 3466108..3466208 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IRJ26_RS18425 (3463575) | 3463575..3463769 | - | 195 | WP_004399291.1 | hypothetical protein | - |
IRJ26_RS18430 (3464722) | 3464722..3465048 | + | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
IRJ26_RS18435 (3465163) | 3465163..3465774 | + | 612 | WP_009967516.1 | lipoprotein | - |
- (3466108) | 3466108..3466208 | - | 101 | NuclAT_2 | - | Antitoxin |
- (3466108) | 3466108..3466208 | - | 101 | NuclAT_2 | - | Antitoxin |
- (3466108) | 3466108..3466208 | - | 101 | NuclAT_2 | - | Antitoxin |
- (3466108) | 3466108..3466208 | - | 101 | NuclAT_2 | - | Antitoxin |
IRJ26_RS18440 (3466149) | 3466149..3466325 | + | 177 | WP_009967515.1 | hypothetical protein | Toxin |
IRJ26_RS18445 (3466344) | 3466344..3466595 | + | 252 | WP_010886546.1 | hypothetical protein | - |
IRJ26_RS18450 (3466640) | 3466640..3466828 | + | 189 | WP_004399547.1 | hypothetical protein | - |
IRJ26_RS18455 (3466910) | 3466910..3468142 | + | 1233 | WP_004399445.1 | hypothetical protein | - |
IRJ26_RS18460 (3468470) | 3468470..3468976 | + | 507 | WP_004399486.1 | hypothetical protein | - |
IRJ26_RS18465 (3469333) | 3469333..3470649 | + | 1317 | WP_004399369.1 | hypothetical protein | - |
IRJ26_RS18470 (3470910) | 3470910..3471137 | + | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 3385454..3534483 | 149029 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T180063 WP_009967515.1 NZ_CP064094:3466149-3466325 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
>T180063 NZ_CP085060:c1993370-1993263 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 101 bp
>AT180063 NZ_CP064094:c3466208-3466108 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | O31941 |
Antitoxin
Download structure file