Detailed information of TA system TA180063

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): yonT-as-bsrG/-
• Location: 3466108..3466325
• Replicon: chromosome
• Accession: NZ_CP064094
• Organism: Bacillus subtilis strain N1108-5at

Toxin (Protein)

• Gene name: yonT
• Uniprot ID: O31941
• Locus tag: IRJ26_RS18440
• Protein ID: WP_009967515.1
• Coordinates: 3466149..3466325 (+)
• Length: 59 a.a.

Antitoxin (RNA)

Gene name	as-bsrG
Locus tag	-
Coordinates	3466108..3466208 (-)

Genomic Context

Location: 3464722..3465048 (327 bp)
Type: Others
Protein ID: WP_009967517.1

Location: 3465163..3465774 (612 bp)
Type: Others
Protein ID: WP_009967516.1

Location: 3466149..3466325 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1

Location: 3466344..3466595 (252 bp)
Type: Others
Protein ID: WP_010886546.1

Location: 3466640..3466828 (189 bp)
Type: Others
Protein ID: WP_004399547.1

Location: 3466910..3468142 (1233 bp)
Type: Others
Protein ID: WP_004399445.1

Location: 3468470..3468976 (507 bp)
Type: Others
Protein ID: WP_004399486.1

Location: 3469333..3470649 (1317 bp)
Type: Others
Protein ID: WP_004399369.1

Location: 3470910..3471137 (228 bp)
Type: Others
Protein ID: WP_004399298.1

Location: 3463575..3463769 (195 bp)
Type: Others
Protein ID: WP_004399291.1

Location: 3466108..3466208 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 3466108..3466208 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 3466108..3466208 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 3466108..3466208 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
IRJ26_RS18425 (3463575)	3463575..3463769	-	195	WP_004399291.1	hypothetical protein	-
IRJ26_RS18430 (3464722)	3464722..3465048	+	327	WP_009967517.1	helix-turn-helix transcriptional regulator	-
IRJ26_RS18435 (3465163)	3465163..3465774	+	612	WP_009967516.1	lipoprotein	-
- (3466108)	3466108..3466208	-	101	NuclAT_2	-	Antitoxin
- (3466108)	3466108..3466208	-	101	NuclAT_2	-	Antitoxin
- (3466108)	3466108..3466208	-	101	NuclAT_2	-	Antitoxin
- (3466108)	3466108..3466208	-	101	NuclAT_2	-	Antitoxin
IRJ26_RS18440 (3466149)	3466149..3466325	+	177	WP_009967515.1	hypothetical protein	Toxin
IRJ26_RS18445 (3466344)	3466344..3466595	+	252	WP_010886546.1	hypothetical protein	-
IRJ26_RS18450 (3466640)	3466640..3466828	+	189	WP_004399547.1	hypothetical protein	-
IRJ26_RS18455 (3466910)	3466910..3468142	+	1233	WP_004399445.1	hypothetical protein	-
IRJ26_RS18460 (3468470)	3468470..3468976	+	507	WP_004399486.1	hypothetical protein	-
IRJ26_RS18465 (3469333)	3469333..3470649	+	1317	WP_004399369.1	hypothetical protein	-
IRJ26_RS18470 (3470910)	3470910..3471137	+	228	WP_004399298.1	helix-turn-helix transcriptional regulator	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0.003	inside	Prophage	-	-	3385454..3534483	149029

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 59 a.a.
• Molecular weight: 6882.45 Da
• Isoelectric Point: 12.8833

>T180063 WP_009967515.1 NZ_CP064094:3466149-3466325 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR

Nucleotide

• Length: 177 bp

>T180063 NZ_CP085060:c1993370-1993263 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 101 bp

>AT180063 NZ_CP064094:c3466208-3466108 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: O31941

Antitoxin