Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | bsrG-as-bsrH/- |
| Location | 2275404..2275694 | Replicon | chromosome |
| Accession | NZ_CP112873 | ||
| Organism | Bacillus subtilis strain O4 | ||
Toxin (Protein)
| Gene name | bsrG | Uniprot ID | L8EAY0 |
| Locus tag | ORF34_RS11765 | Protein ID | WP_009967548.1 |
| Coordinates | 2275404..2275520 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrH | ||
| Locus tag | - | ||
| Coordinates | 2275515..2275694 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORF34_RS11730 (2271331) | 2271331..2271501 | - | 171 | WP_009967544.1 | bacteriocin sublancin-168 | - |
| ORF34_RS11735 (2271798) | 2271798..2272115 | - | 318 | WP_009967545.1 | sublancin immunity protein SunI | - |
| ORF34_RS11740 (2272217) | 2272217..2273467 | - | 1251 | WP_004398504.1 | UV-damage repair protein uvrX | - |
| ORF34_RS11745 (2273460) | 2273460..2273792 | - | 333 | WP_004398710.1 | YolD-like family protein | - |
| ORF34_RS11750 (2273966) | 2273966..2274301 | + | 336 | WP_004399073.1 | hypothetical protein | - |
| ORF34_RS11755 (2274344) | 2274344..2274700 | - | 357 | WP_004398595.1 | hypothetical protein | - |
| ORF34_RS11760 (2274706) | 2274706..2275173 | - | 468 | WP_003246138.1 | YolA family protein | - |
| ORF34_RS11765 (2275404) | 2275404..2275520 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
| - (2275515) | 2275515..2275694 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2275515) | 2275515..2275694 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2275515) | 2275515..2275694 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2275515) | 2275515..2275694 | - | 180 | NuclAT_1 | - | Antitoxin |
| ORF34_RS11770 (2275799) | 2275799..2276332 | - | 534 | WP_004399156.1 | GNAT family protein | - |
| ORF34_RS11775 (2276368) | 2276368..2276946 | - | 579 | WP_004399123.1 | SMI1/KNR4 family protein | - |
| ORF34_RS11780 (2277010) | 2277010..2277507 | - | 498 | WP_003246188.1 | SMI1/KNR4 family protein | - |
| ORF34_RS11785 (2277516) | 2277516..2279231 | - | 1716 | WP_004398855.1 | ribonuclease YeeF family protein | - |
| ORF34_RS11790 (2279331) | 2279331..2279888 | - | 558 | WP_003246042.1 | SMI1/KNR4 family protein | - |
| ORF34_RS11795 (2280023) | 2280023..2280157 | + | 135 | WP_234047931.1 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2153436..2288218 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T264912 WP_009967548.1 NZ_CP112873:2275404-2275520 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
Antitoxin
Download Length: 180 bp
>AT264912 NZ_CP112873:c2275694-2275515 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
