Detailed information of TA system TA264912

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): bsrG-as-bsrH/-
• Location: 2275404..2275694
• Replicon: chromosome
• Accession: NZ_CP112873
• Organism: Bacillus subtilis strain O4

Toxin (Protein)

• Gene name: bsrG
• Uniprot ID: L8EAY0
• Locus tag: ORF34_RS11765
• Protein ID: WP_009967548.1
• Coordinates: 2275404..2275520 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	as-bsrH
Locus tag	-
Coordinates	2275515..2275694 (-)

Genomic Context

Location: 2273966..2274301 (336 bp)
Type: Others
Protein ID: WP_004399073.1

Location: 2275404..2275520 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1

Location: 2280023..2280157 (135 bp)
Type: Others
Protein ID: WP_234047931.1

Location: 2271331..2271501 (171 bp)
Type: Others
Protein ID: WP_009967544.1

Location: 2271798..2272115 (318 bp)
Type: Others
Protein ID: WP_009967545.1

Location: 2272217..2273467 (1251 bp)
Type: Others
Protein ID: WP_004398504.1

Location: 2273460..2273792 (333 bp)
Type: Others
Protein ID: WP_004398710.1

Location: 2274344..2274700 (357 bp)
Type: Others
Protein ID: WP_004398595.1

Location: 2274706..2275173 (468 bp)
Type: Others
Protein ID: WP_003246138.1

Location: 2275515..2275694 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2275515..2275694 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2275515..2275694 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2275515..2275694 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2275799..2276332 (534 bp)
Type: Others
Protein ID: WP_004399156.1

Location: 2276368..2276946 (579 bp)
Type: Others
Protein ID: WP_004399123.1

Location: 2277010..2277507 (498 bp)
Type: Others
Protein ID: WP_003246188.1

Location: 2277516..2279231 (1716 bp)
Type: Others
Protein ID: WP_004398855.1

Location: 2279331..2279888 (558 bp)
Type: Others
Protein ID: WP_003246042.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ORF34_RS11730 (2271331)	2271331..2271501	-	171	WP_009967544.1	bacteriocin sublancin-168	-
ORF34_RS11735 (2271798)	2271798..2272115	-	318	WP_009967545.1	sublancin immunity protein SunI	-
ORF34_RS11740 (2272217)	2272217..2273467	-	1251	WP_004398504.1	UV-damage repair protein uvrX	-
ORF34_RS11745 (2273460)	2273460..2273792	-	333	WP_004398710.1	YolD-like family protein	-
ORF34_RS11750 (2273966)	2273966..2274301	+	336	WP_004399073.1	hypothetical protein	-
ORF34_RS11755 (2274344)	2274344..2274700	-	357	WP_004398595.1	hypothetical protein	-
ORF34_RS11760 (2274706)	2274706..2275173	-	468	WP_003246138.1	YolA family protein	-
ORF34_RS11765 (2275404)	2275404..2275520	+	117	WP_009967548.1	type I toxin-antitoxin system toxin BsrG	Toxin
- (2275515)	2275515..2275694	-	180	NuclAT_1	-	Antitoxin
- (2275515)	2275515..2275694	-	180	NuclAT_1	-	Antitoxin
- (2275515)	2275515..2275694	-	180	NuclAT_1	-	Antitoxin
- (2275515)	2275515..2275694	-	180	NuclAT_1	-	Antitoxin
ORF34_RS11770 (2275799)	2275799..2276332	-	534	WP_004399156.1	GNAT family protein	-
ORF34_RS11775 (2276368)	2276368..2276946	-	579	WP_004399123.1	SMI1/KNR4 family protein	-
ORF34_RS11780 (2277010)	2277010..2277507	-	498	WP_003246188.1	SMI1/KNR4 family protein	-
ORF34_RS11785 (2277516)	2277516..2279231	-	1716	WP_004398855.1	ribonuclease YeeF family protein	-
ORF34_RS11790 (2279331)	2279331..2279888	-	558	WP_003246042.1	SMI1/KNR4 family protein	-
ORF34_RS11795 (2280023)	2280023..2280157	+	135	WP_234047931.1	transposase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0	inside	Prophage	-	-	2153436..2288218	134782

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-38)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4336.39 Da
• Isoelectric Point: 10.1022

>T264912 WP_009967548.1 NZ_CP112873:2275404-2275520 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Nucleotide

• Length: 117 bp

Antitoxin

Nucleotide

• Length: 180 bp

>AT264912 NZ_CP112873:c2275694-2275515 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A7Z7EVU9

Antitoxin