Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2268276..2268493 | Replicon | chromosome |
Accession | NZ_OX419580 | ||
Organism | Bacillus subtilis isolate NRS6116 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | KJP60_RS11815 | Protein ID | WP_009967515.1 |
Coordinates | 2268317..2268493 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2268276..2268376 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP60_RS11785 | 2263505..2263732 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
KJP60_RS11790 | 2263993..2265309 | - | 1317 | Protein_2274 | hypothetical protein | - |
KJP60_RS11795 | 2265666..2266172 | - | 507 | WP_004399486.1 | hypothetical protein | - |
KJP60_RS11800 | 2266500..2267732 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
KJP60_RS11805 | 2267814..2268002 | - | 189 | WP_004399547.1 | hypothetical protein | - |
KJP60_RS11810 | 2268047..2268298 | - | 252 | WP_010886546.1 | hypothetical protein | - |
- | 2268276..2268376 | + | 101 | - | - | Antitoxin |
KJP60_RS11815 | 2268317..2268493 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- | 2268434..2268534 | + | 101 | NuclAT_2 | - | - |
- | 2268434..2268534 | + | 101 | NuclAT_2 | - | - |
- | 2268434..2268534 | + | 101 | NuclAT_2 | - | - |
- | 2268434..2268534 | + | 101 | NuclAT_2 | - | - |
KJP60_RS11820 | 2268868..2269479 | - | 612 | WP_009967516.1 | lipoprotein | - |
KJP60_RS11825 | 2269594..2269920 | - | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
KJP60_RS11830 | 2270873..2271067 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2200159..2334941 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T296935 WP_009967515.1 NZ_OX419580:c2268493-2268317 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT296935 NZ_OX419580:2268276-2268376 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|