Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrG-as-bsrH/- |
Location | 2273600..2273890 | Replicon | chromosome |
Accession | NZ_CP011115 | ||
Organism | Bacillus subtilis KCTC 1028 = ATCC 6051a strain KCTC 1028 |
Toxin (Protein)
Gene name | bsrG | Uniprot ID | L8EAY0 |
Locus tag | O7A_RS23415 | Protein ID | WP_009967548.1 |
Coordinates | 2273600..2273716 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | as-bsrH | ||
Locus tag | - | ||
Coordinates | 2273711..2273890 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O7A_RS11785 | 2269527..2269697 | - | 171 | WP_009967544.1 | bacteriocin sublancin-168 | - |
O7A_RS11790 | 2269994..2270311 | - | 318 | WP_009967545.1 | sublancin immunity protein SunI | - |
O7A_RS11795 | 2270413..2271663 | - | 1251 | WP_004398504.1 | UV-damage repair protein uvrX | - |
O7A_RS11800 | 2271656..2271988 | - | 333 | WP_004398710.1 | YolD-like family protein | - |
O7A_RS11805 | 2272162..2272497 | + | 336 | WP_004399073.1 | hypothetical protein | - |
O7A_RS11810 | 2272540..2272896 | - | 357 | WP_004398595.1 | hypothetical protein | - |
O7A_RS11815 | 2272902..2273369 | - | 468 | WP_003246138.1 | YolA family protein | - |
O7A_RS23415 | 2273600..2273716 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
- | 2273711..2273890 | - | 180 | NuclAT_1 | - | Antitoxin |
- | 2273711..2273890 | - | 180 | NuclAT_1 | - | Antitoxin |
- | 2273711..2273890 | - | 180 | NuclAT_1 | - | Antitoxin |
- | 2273711..2273890 | - | 180 | NuclAT_1 | - | Antitoxin |
O7A_RS11825 | 2273995..2274528 | - | 534 | WP_004399156.1 | GNAT family N-acetyltransferase | - |
O7A_RS11830 | 2274564..2275142 | - | 579 | WP_004399123.1 | SMI1/KNR4 family protein | - |
O7A_RS11835 | 2275206..2275703 | - | 498 | WP_003246188.1 | SMI1/KNR4 family protein | - |
O7A_RS11840 | 2275712..2277427 | - | 1716 | WP_004398855.1 | ribonuclease YeeF family protein | - |
O7A_RS11845 | 2277527..2278084 | - | 558 | WP_003246042.1 | SMI1/KNR4 family protein | - |
O7A_RS22765 | 2278168..2278353 | + | 186 | WP_003245951.1 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2151632..2286414 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T53442 WP_009967548.1 NZ_CP011115:2273600-2273716 [Bacillus subtilis KCTC 1028 = ATCC 6051a]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
>T53442 NZ_CP011115:2273600-2273716 [Bacillus subtilis KCTC 1028 = ATCC 6051a]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
Antitoxin
Download Length: 180 bp
>AT53442 NZ_CP011115:c2273890-2273711 [Bacillus subtilis KCTC 1028 = ATCC 6051a]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|