Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | bsrG-as-bsrG/- |
| Location | 2252693..2252983 | Replicon | chromosome |
| Accession | NZ_CP101937 | ||
| Organism | Bacillus subtilis strain RUB331 | ||
Toxin (Protein)
| Gene name | bsrG | Uniprot ID | L8EAY0 |
| Locus tag | NP435_RS11610 | Protein ID | WP_009967548.1 |
| Coordinates | 2252693..2252809 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrG | ||
| Locus tag | - | ||
| Coordinates | 2252804..2252983 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP435_RS11575 (2248620) | 2248620..2248790 | - | 171 | WP_009967544.1 | bacteriocin sublancin-168 | - |
| NP435_RS11580 (2249087) | 2249087..2249404 | - | 318 | WP_009967545.1 | sublancin immunity protein SunI | - |
| NP435_RS11585 (2249506) | 2249506..2250756 | - | 1251 | WP_004398504.1 | UV-damage repair protein uvrX | - |
| NP435_RS11590 (2250749) | 2250749..2251081 | - | 333 | WP_004398710.1 | YolD-like family protein | - |
| NP435_RS11595 (2251255) | 2251255..2251590 | + | 336 | WP_004399073.1 | hypothetical protein | - |
| NP435_RS11600 (2251633) | 2251633..2251989 | - | 357 | WP_004398595.1 | hypothetical protein | - |
| NP435_RS11605 (2251995) | 2251995..2252462 | - | 468 | WP_003246138.1 | YolA family protein | - |
| NP435_RS11610 (2252693) | 2252693..2252809 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
| - (2252804) | 2252804..2252983 | - | 180 | NuclAT_0 | - | Antitoxin |
| - (2252804) | 2252804..2252983 | - | 180 | NuclAT_0 | - | Antitoxin |
| - (2252804) | 2252804..2252983 | - | 180 | NuclAT_0 | - | Antitoxin |
| - (2252804) | 2252804..2252983 | - | 180 | NuclAT_0 | - | Antitoxin |
| NP435_RS11615 (2253088) | 2253088..2253621 | - | 534 | WP_004399156.1 | GNAT family protein | - |
| NP435_RS11620 (2253657) | 2253657..2254235 | - | 579 | WP_004399123.1 | SMI1/KNR4 family protein | - |
| NP435_RS11625 (2254299) | 2254299..2254796 | - | 498 | WP_003246188.1 | SMI1/KNR4 family protein | - |
| NP435_RS11630 (2254805) | 2254805..2256520 | - | 1716 | WP_004398855.1 | ribonuclease YeeF family protein | - |
| NP435_RS11635 (2256620) | 2256620..2257177 | - | 558 | WP_003246042.1 | SMI1/KNR4 family protein | - |
| NP435_RS11640 (2257312) | 2257312..2257446 | + | 135 | WP_234047931.1 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2130725..2265507 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T253033 WP_009967548.1 NZ_CP101937:2252693-2252809 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
Antitoxin
Download Length: 180 bp
>AT253033 NZ_CP101937:c2252983-2252804 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
