Detailed information of TA system TA253033

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): bsrG-as-bsrG/-
• Location: 2252693..2252983
• Replicon: chromosome
• Accession: NZ_CP101937
• Organism: Bacillus subtilis strain RUB331

Toxin (Protein)

• Gene name: bsrG
• Uniprot ID: L8EAY0
• Locus tag: NP435_RS11610
• Protein ID: WP_009967548.1
• Coordinates: 2252693..2252809 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	as-bsrG
Locus tag	-
Coordinates	2252804..2252983 (-)

Genomic Context

Location: 2251255..2251590 (336 bp)
Type: Others
Protein ID: WP_004399073.1

Location: 2252693..2252809 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1

Location: 2257312..2257446 (135 bp)
Type: Others
Protein ID: WP_234047931.1

Location: 2248620..2248790 (171 bp)
Type: Others
Protein ID: WP_009967544.1

Location: 2249087..2249404 (318 bp)
Type: Others
Protein ID: WP_009967545.1

Location: 2249506..2250756 (1251 bp)
Type: Others
Protein ID: WP_004398504.1

Location: 2250749..2251081 (333 bp)
Type: Others
Protein ID: WP_004398710.1

Location: 2251633..2251989 (357 bp)
Type: Others
Protein ID: WP_004398595.1

Location: 2251995..2252462 (468 bp)
Type: Others
Protein ID: WP_003246138.1

Location: 2252804..2252983 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_0

Location: 2252804..2252983 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_0

Location: 2252804..2252983 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_0

Location: 2252804..2252983 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_0

Location: 2253088..2253621 (534 bp)
Type: Others
Protein ID: WP_004399156.1

Location: 2253657..2254235 (579 bp)
Type: Others
Protein ID: WP_004399123.1

Location: 2254299..2254796 (498 bp)
Type: Others
Protein ID: WP_003246188.1

Location: 2254805..2256520 (1716 bp)
Type: Others
Protein ID: WP_004398855.1

Location: 2256620..2257177 (558 bp)
Type: Others
Protein ID: WP_003246042.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NP435_RS11575 (2248620)	2248620..2248790	-	171	WP_009967544.1	bacteriocin sublancin-168	-
NP435_RS11580 (2249087)	2249087..2249404	-	318	WP_009967545.1	sublancin immunity protein SunI	-
NP435_RS11585 (2249506)	2249506..2250756	-	1251	WP_004398504.1	UV-damage repair protein uvrX	-
NP435_RS11590 (2250749)	2250749..2251081	-	333	WP_004398710.1	YolD-like family protein	-
NP435_RS11595 (2251255)	2251255..2251590	+	336	WP_004399073.1	hypothetical protein	-
NP435_RS11600 (2251633)	2251633..2251989	-	357	WP_004398595.1	hypothetical protein	-
NP435_RS11605 (2251995)	2251995..2252462	-	468	WP_003246138.1	YolA family protein	-
NP435_RS11610 (2252693)	2252693..2252809	+	117	WP_009967548.1	type I toxin-antitoxin system toxin BsrG	Toxin
- (2252804)	2252804..2252983	-	180	NuclAT_0	-	Antitoxin
- (2252804)	2252804..2252983	-	180	NuclAT_0	-	Antitoxin
- (2252804)	2252804..2252983	-	180	NuclAT_0	-	Antitoxin
- (2252804)	2252804..2252983	-	180	NuclAT_0	-	Antitoxin
NP435_RS11615 (2253088)	2253088..2253621	-	534	WP_004399156.1	GNAT family protein	-
NP435_RS11620 (2253657)	2253657..2254235	-	579	WP_004399123.1	SMI1/KNR4 family protein	-
NP435_RS11625 (2254299)	2254299..2254796	-	498	WP_003246188.1	SMI1/KNR4 family protein	-
NP435_RS11630 (2254805)	2254805..2256520	-	1716	WP_004398855.1	ribonuclease YeeF family protein	-
NP435_RS11635 (2256620)	2256620..2257177	-	558	WP_003246042.1	SMI1/KNR4 family protein	-
NP435_RS11640 (2257312)	2257312..2257446	+	135	WP_234047931.1	transposase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0	inside	Prophage	-	-	2130725..2265507	134782

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-38)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4336.39 Da
• Isoelectric Point: 10.1022

>T253033 WP_009967548.1 NZ_CP101937:2252693-2252809 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Nucleotide

• Length: 117 bp

Antitoxin

Nucleotide

• Length: 180 bp

>AT253033 NZ_CP101937:c2252983-2252804 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A7Z7EVU9

Antitoxin