Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 2237794..2238011 | Replicon | chromosome |
Accession | NZ_LN649259 | ||
Organism | Bacillus subtilis strain BS49 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | VV34_RS22940 | Protein ID | WP_009967515.1 |
Coordinates | 2237794..2237970 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 2237911..2238011 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VV34_RS11585 | 2232982..2233209 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
VV34_RS11590 | 2233470..2234786 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
VV34_RS11595 | 2235143..2235649 | - | 507 | WP_004399486.1 | hypothetical protein | - |
VV34_RS11600 | 2235977..2237209 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
VV34_RS11605 | 2237291..2237479 | - | 189 | WP_004399547.1 | hypothetical protein | - |
VV34_RS22935 | 2237524..2237775 | - | 252 | WP_010886546.1 | hypothetical protein | - |
VV34_RS22940 | 2237794..2237970 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- | 2237911..2238011 | + | 101 | NuclAT_2 | - | Antitoxin |
- | 2237911..2238011 | + | 101 | NuclAT_2 | - | Antitoxin |
- | 2237911..2238011 | + | 101 | NuclAT_2 | - | Antitoxin |
- | 2237911..2238011 | + | 101 | NuclAT_2 | - | Antitoxin |
VV34_RS11615 | 2238345..2238956 | - | 612 | WP_009967516.1 | lipoprotein | - |
VV34_RS11620 | 2239071..2239397 | - | 327 | WP_009967517.1 | helix-turn-helix domain-containing protein | - |
VV34_RS11625 | 2240350..2240544 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2169638..2304418 | 134780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T285509 WP_009967515.1 NZ_LN649259:c2237970-2237794 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT285509 NZ_LN649259:2237911-2238011 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|