Detailed information of TA system TA296937

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): yonT-as-bsrG/-
• Location: 2268317..2268534
• Replicon: chromosome
• Accession: NZ_OX419580
• Organism: Bacillus subtilis isolate NRS6116

Toxin (Protein)

• Gene name: yonT
• Uniprot ID: O31941
• Locus tag: KJP60_RS11815
• Protein ID: WP_009967515.1
• Coordinates: 2268317..2268493 (-)
• Length: 59 a.a.

Antitoxin (RNA)

Gene name	as-bsrG
Locus tag	-
Coordinates	2268434..2268534 (+)

Genomic Context

Location: 2268434..2268534 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2268434..2268534 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2268434..2268534 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2268434..2268534 (101 bp)
Type: Antitoxin
Protein ID: NuclAT_2

Location: 2270873..2271067 (195 bp)
Type: Others
Protein ID: WP_004399291.1

Location: 2263505..2263732 (228 bp)
Type: Others
Protein ID: WP_004399298.1

Location: 2263993..2265309 (1317 bp)
Type: Others
Protein ID: Protein_2274

Location: 2265666..2266172 (507 bp)
Type: Others
Protein ID: WP_004399486.1

Location: 2266500..2267732 (1233 bp)
Type: Others
Protein ID: WP_004399445.1

Location: 2267814..2268002 (189 bp)
Type: Others
Protein ID: WP_004399547.1

Location: 2268047..2268298 (252 bp)
Type: Others
Protein ID: WP_010886546.1

Location: 2268317..2268493 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1

Location: 2268868..2269479 (612 bp)
Type: Others
Protein ID: WP_009967516.1

Location: 2269594..2269920 (327 bp)
Type: Others
Protein ID: WP_009967517.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
KJP60_RS11785 (2263505)	2263505..2263732	-	228	WP_004399298.1	helix-turn-helix transcriptional regulator	-
KJP60_RS11790 (2263993)	2263993..2265309	-	1317	Protein_2274	hypothetical protein	-
KJP60_RS11795 (2265666)	2265666..2266172	-	507	WP_004399486.1	hypothetical protein	-
KJP60_RS11800 (2266500)	2266500..2267732	-	1233	WP_004399445.1	hypothetical protein	-
KJP60_RS11805 (2267814)	2267814..2268002	-	189	WP_004399547.1	hypothetical protein	-
KJP60_RS11810 (2268047)	2268047..2268298	-	252	WP_010886546.1	hypothetical protein	-
KJP60_RS11815 (2268317)	2268317..2268493	-	177	WP_009967515.1	hypothetical protein	Toxin
- (2268434)	2268434..2268534	+	101	NuclAT_2	-	Antitoxin
- (2268434)	2268434..2268534	+	101	NuclAT_2	-	Antitoxin
- (2268434)	2268434..2268534	+	101	NuclAT_2	-	Antitoxin
- (2268434)	2268434..2268534	+	101	NuclAT_2	-	Antitoxin
KJP60_RS11820 (2268868)	2268868..2269479	-	612	WP_009967516.1	lipoprotein	-
KJP60_RS11825 (2269594)	2269594..2269920	-	327	WP_009967517.1	helix-turn-helix transcriptional regulator	-
KJP60_RS11830 (2270873)	2270873..2271067	+	195	WP_004399291.1	hypothetical protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0	inside	Prophage	-	-	2200159..2334941	134782

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Sequences

Toxin

Protein

• Length: 59 a.a.
• Molecular weight: 6882.45 Da
• Isoelectric Point: 12.8833

>T296937 WP_009967515.1 NZ_OX419580:c2268493-2268317 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR

Nucleotide

• Length: 177 bp

Antitoxin

Nucleotide

• Length: 101 bp

>AT296937 NZ_OX419580:2268434-2268534 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: O31941

Antitoxin