Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2199358..2199575 | Replicon | chromosome |
Accession | NZ_CP015004 | ||
Organism | Bacillus subtilis strain SZMC 6179J isolate B23 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | A3772_RS11405 | Protein ID | WP_009967515.1 |
Coordinates | 2199399..2199575 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2199358..2199458 (+) |
Genomic Context
Location: 2199358..2199458 (101 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 2199516..2199616 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2199516..2199616 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2199516..2199616 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2199516..2199616 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2201955..2202149 (195 bp)
Type: Others
Protein ID: WP_004399291.1
Type: Others
Protein ID: WP_004399291.1
Location: 2194587..2194814 (228 bp)
Type: Others
Protein ID: WP_004399298.1
Type: Others
Protein ID: WP_004399298.1
Location: 2195075..2196391 (1317 bp)
Type: Others
Protein ID: Protein_2161
Type: Others
Protein ID: Protein_2161
Location: 2196748..2197254 (507 bp)
Type: Others
Protein ID: WP_004399486.1
Type: Others
Protein ID: WP_004399486.1
Location: 2197582..2198814 (1233 bp)
Type: Others
Protein ID: WP_004399445.1
Type: Others
Protein ID: WP_004399445.1
Location: 2198896..2199084 (189 bp)
Type: Others
Protein ID: WP_004399547.1
Type: Others
Protein ID: WP_004399547.1
Location: 2199129..2199380 (252 bp)
Type: Others
Protein ID: WP_010886546.1
Type: Others
Protein ID: WP_010886546.1
Location: 2199399..2199575 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1
Type: Toxin
Protein ID: WP_009967515.1
Location: 2199950..2200561 (612 bp)
Type: Others
Protein ID: WP_009967516.1
Type: Others
Protein ID: WP_009967516.1
Location: 2200676..2201002 (327 bp)
Type: Others
Protein ID: WP_009967517.1
Type: Others
Protein ID: WP_009967517.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A3772_RS11380 | 2194587..2194814 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
A3772_RS11385 | 2195075..2196391 | - | 1317 | Protein_2161 | hypothetical protein | - |
A3772_RS11390 | 2196748..2197254 | - | 507 | WP_004399486.1 | hypothetical protein | - |
A3772_RS11395 | 2197582..2198814 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
A3772_RS11400 | 2198896..2199084 | - | 189 | WP_004399547.1 | hypothetical protein | - |
A3772_RS22260 | 2199129..2199380 | - | 252 | WP_010886546.1 | hypothetical protein | - |
- | 2199358..2199458 | + | 101 | - | - | Antitoxin |
A3772_RS11405 | 2199399..2199575 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- | 2199516..2199616 | + | 101 | NuclAT_2 | - | - |
- | 2199516..2199616 | + | 101 | NuclAT_2 | - | - |
- | 2199516..2199616 | + | 101 | NuclAT_2 | - | - |
- | 2199516..2199616 | + | 101 | NuclAT_2 | - | - |
A3772_RS11410 | 2199950..2200561 | - | 612 | WP_009967516.1 | lipoprotein | - |
A3772_RS11415 | 2200676..2201002 | - | 327 | WP_009967517.1 | helix-turn-helix domain-containing protein | - |
A3772_RS11420 | 2201955..2202149 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2131241..2266023 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T62007 WP_009967515.1 NZ_CP015004:c2199575-2199399 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
>T62007 NZ_CP015004:c2199575-2199399 [Bacillus subtilis]
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
Antitoxin
Download Length: 101 bp
>AT62007 NZ_CP015004:2199358-2199458 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | O31941 |
Antitoxin
Download structure file