Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | bsrG-as-bsrH/- |
Location | 2242194..2242484 | Replicon | chromosome |
Accession | NZ_AP024623 | ||
Organism | Bacillus subtilis strain BEST3102 |
Toxin (Protein)
Gene name | bsrG | Uniprot ID | L8EAY0 |
Locus tag | K6J99_RS11515 | Protein ID | WP_009967548.1 |
Coordinates | 2242194..2242310 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | as-bsrH | ||
Locus tag | - | ||
Coordinates | 2242305..2242484 (-) |
Genomic Context
Location: 2240756..2241091 (336 bp)
Type: Others
Protein ID: WP_004399073.1
Type: Others
Protein ID: WP_004399073.1
Location: 2242194..2242310 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1
Type: Toxin
Protein ID: WP_009967548.1
Location: 2246813..2246947 (135 bp)
Type: Others
Protein ID: WP_234047931.1
Type: Others
Protein ID: WP_234047931.1
Location: 2238121..2238291 (171 bp)
Type: Others
Protein ID: WP_009967544.1
Type: Others
Protein ID: WP_009967544.1
Location: 2238588..2238905 (318 bp)
Type: Others
Protein ID: WP_009967545.1
Type: Others
Protein ID: WP_009967545.1
Location: 2239007..2240257 (1251 bp)
Type: Others
Protein ID: WP_004398504.1
Type: Others
Protein ID: WP_004398504.1
Location: 2240250..2240582 (333 bp)
Type: Others
Protein ID: WP_004398710.1
Type: Others
Protein ID: WP_004398710.1
Location: 2241134..2241490 (357 bp)
Type: Others
Protein ID: WP_004398595.1
Type: Others
Protein ID: WP_004398595.1
Location: 2241496..2241963 (468 bp)
Type: Others
Protein ID: WP_003246138.1
Type: Others
Protein ID: WP_003246138.1
Location: 2242305..2242484 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2242305..2242484 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2242305..2242484 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2242305..2242484 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1
Type: Antitoxin
Protein ID: NuclAT_1
Location: 2242589..2243122 (534 bp)
Type: Others
Protein ID: WP_004399156.1
Type: Others
Protein ID: WP_004399156.1
Location: 2243158..2243736 (579 bp)
Type: Others
Protein ID: WP_004399123.1
Type: Others
Protein ID: WP_004399123.1
Location: 2243800..2244297 (498 bp)
Type: Others
Protein ID: WP_003246188.1
Type: Others
Protein ID: WP_003246188.1
Location: 2244306..2246021 (1716 bp)
Type: Others
Protein ID: WP_004398855.1
Type: Others
Protein ID: WP_004398855.1
Location: 2246121..2246678 (558 bp)
Type: Others
Protein ID: WP_003246042.1
Type: Others
Protein ID: WP_003246042.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J99_RS11480 (2238121) | 2238121..2238291 | - | 171 | WP_009967544.1 | bacteriocin sublancin-168 | - |
K6J99_RS11485 (2238588) | 2238588..2238905 | - | 318 | WP_009967545.1 | sublancin immunity protein SunI | - |
K6J99_RS11490 (2239007) | 2239007..2240257 | - | 1251 | WP_004398504.1 | UV-damage repair protein uvrX | - |
K6J99_RS11495 (2240250) | 2240250..2240582 | - | 333 | WP_004398710.1 | YolD-like family protein | - |
K6J99_RS11500 (2240756) | 2240756..2241091 | + | 336 | WP_004399073.1 | hypothetical protein | - |
K6J99_RS11505 (2241134) | 2241134..2241490 | - | 357 | WP_004398595.1 | hypothetical protein | - |
K6J99_RS11510 (2241496) | 2241496..2241963 | - | 468 | WP_003246138.1 | YolA family protein | - |
K6J99_RS11515 (2242194) | 2242194..2242310 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
- (2242305) | 2242305..2242484 | - | 180 | NuclAT_1 | - | Antitoxin |
- (2242305) | 2242305..2242484 | - | 180 | NuclAT_1 | - | Antitoxin |
- (2242305) | 2242305..2242484 | - | 180 | NuclAT_1 | - | Antitoxin |
- (2242305) | 2242305..2242484 | - | 180 | NuclAT_1 | - | Antitoxin |
K6J99_RS11520 (2242589) | 2242589..2243122 | - | 534 | WP_004399156.1 | GNAT family protein | - |
K6J99_RS11525 (2243158) | 2243158..2243736 | - | 579 | WP_004399123.1 | SMI1/KNR4 family protein | - |
K6J99_RS11530 (2243800) | 2243800..2244297 | - | 498 | WP_003246188.1 | SMI1/KNR4 family protein | - |
K6J99_RS11535 (2244306) | 2244306..2246021 | - | 1716 | WP_004398855.1 | ribonuclease YeeF family protein | - |
K6J99_RS11540 (2246121) | 2246121..2246678 | - | 558 | WP_003246042.1 | SMI1/KNR4 family protein | - |
K6J99_RS11545 (2246813) | 2246813..2246947 | + | 135 | WP_234047931.1 | transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2120228..2255008 | 134780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T39022 WP_009967548.1 NZ_AP024623:2242194-2242310 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
>T39022 NZ_AP024623:2242194-2242310 [Bacillus subtilis]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
Antitoxin
Download Length: 180 bp
>AT39022 NZ_AP024623:c2242484-2242305 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z7EVU9 |
Antitoxin
Download structure file