Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) bsrG-as-bsrH/-
Location 2158692..2158982 Replicon chromosome
Accession NZ_CP125762
Organism Bacillus subtilis strain KRS015

Toxin (Protein)


Gene name bsrG Uniprot ID L8EAY0
Locus tag QLQ05_RS11895 Protein ID WP_009967548.1
Coordinates 2158866..2158982 (-) Length 39 a.a.

Antitoxin (RNA)


Gene name as-bsrH
Locus tag -
Coordinates 2158692..2158871 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ05_RS11865 (2154229) 2154229..2154363 - 135 WP_234047931.1 transposase -
QLQ05_RS11870 (2154498) 2154498..2155055 + 558 WP_003246042.1 SMI1/KNR4 family protein -
QLQ05_RS11875 (2155155) 2155155..2156870 + 1716 WP_004398855.1 ribonuclease YeeF family protein -
QLQ05_RS11880 (2156879) 2156879..2157376 + 498 WP_003246188.1 SMI1/KNR4 family protein -
QLQ05_RS11885 (2157440) 2157440..2158018 + 579 WP_004399123.1 SMI1/KNR4 family protein -
QLQ05_RS11890 (2158054) 2158054..2158587 + 534 WP_004399156.1 GNAT family protein -
- (2158692) 2158692..2158871 + 180 NuclAT_3 - Antitoxin
- (2158692) 2158692..2158871 + 180 NuclAT_3 - Antitoxin
- (2158692) 2158692..2158871 + 180 NuclAT_3 - Antitoxin
- (2158692) 2158692..2158871 + 180 NuclAT_3 - Antitoxin
QLQ05_RS11895 (2158866) 2158866..2158982 - 117 WP_009967548.1 type I toxin-antitoxin system toxin BsrG Toxin
QLQ05_RS11900 (2159213) 2159213..2159680 + 468 WP_003246138.1 YolA family protein -
QLQ05_RS11905 (2159686) 2159686..2160042 + 357 WP_004398595.1 hypothetical protein -
QLQ05_RS11910 (2160085) 2160085..2160420 - 336 WP_004399073.1 hypothetical protein -
QLQ05_RS11915 (2160594) 2160594..2160926 + 333 WP_004398710.1 YolD-like family protein -
QLQ05_RS11920 (2160919) 2160919..2162169 + 1251 WP_004398504.1 UV-damage repair protein uvrX -
QLQ05_RS11925 (2162271) 2162271..2162588 + 318 WP_009967545.1 sublancin immunity protein SunI -
QLQ05_RS11930 (2162885) 2162885..2163055 + 171 WP_009967544.1 bacteriocin sublancin-168 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2012030..2280951 268921


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Small toxic protein BsrE-like

(1-38)


Sequences

Toxin        


Download         Length: 39 a.a.        Molecular weight: 4336.39 Da        Isoelectric Point: 10.1022

>T282369 WP_009967548.1 NZ_CP125762:c2158982-2158866 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Download         Length: 117 bp

Antitoxin


Download         Length: 180 bp

>AT282369 NZ_CP125762:2158692-2158871 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Z7EVU9

Antitoxin

Download structure file

References