Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 3118842..3119134 | Replicon | chromosome |
| Accession | NC_004668 | ||
| Organism | Enterococcus faecalis V583 | ||
| T1TAdb ID | TA05738 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | EF_RS16860 | Protein ID | WP_021164545.1 |
| Coordinates | 3118842..3118946 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 3118879..3119134 (-) |
Genomic Context
Location: 3116624..3118240 (1617 bp)
Type: Others
Protein ID: WP_002379014.1
Type: Others
Protein ID: WP_002379014.1
Location: 3118842..3118946 (105 bp)
Type: Toxin
Protein ID: WP_021164545.1
Type: Toxin
Protein ID: WP_021164545.1
Location: 3123490..3123633 (144 bp)
Type: Others
Protein ID: WP_002387585.1
Type: Others
Protein ID: WP_002387585.1
Location: 3114226..3114858 (633 bp)
Type: Others
Protein ID: WP_002358972.1
Type: Others
Protein ID: WP_002358972.1
Location: 3114867..3116162 (1296 bp)
Type: Others
Protein ID: WP_002379013.1
Type: Others
Protein ID: WP_002379013.1
Location: 3118879..3119134 (256 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 3119136..3122894 (3759 bp)
Type: Others
Protein ID: WP_010706868.1
Type: Others
Protein ID: WP_010706868.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EF_RS15330 (EF3241) | 3114226..3114858 | - | 633 | WP_002358972.1 | RloB family protein | - |
| EF_RS15335 (EF3242) | 3114867..3116162 | - | 1296 | WP_002379013.1 | ATP-binding protein | - |
| EF_RS15340 (EF3245) | 3116624..3118240 | + | 1617 | WP_002379014.1 | phosphatase PAP2/LCP family protein | - |
| EF_RS16860 | 3118842..3118946 | + | 105 | WP_021164545.1 | putative holin-like toxin | Toxin |
| - | 3118879..3119134 | - | 256 | - | - | Antitoxin |
| EF_RS15350 (EF3248) | 3119136..3122894 | - | 3759 | WP_010706868.1 | WxL domain-containing protein | - |
| EF_RS15355 (EF3249) | 3123490..3123633 | + | 144 | WP_002387585.1 | putative holin-like toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3813.70 Da Isoelectric Point: 10.3686
>T10204 WP_021164545.1 NC_004668:3118842-3118946 [Enterococcus faecalis V583]
MSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 105 bp
>T10204 NC_004668:3118842-3118946 [Enterococcus faecalis V583]
TTGTCAGCATATGAAACAATTCAGACAATTCTTGGGTTTGGTATGTTTACCATTGCTTTGATTGCGCTGATTGTGAAATT
GCTTAAAAATGACAAGAAAAAATAA
TTGTCAGCATATGAAACAATTCAGACAATTCTTGGGTTTGGTATGTTTACCATTGCTTTGATTGCGCTGATTGTGAAATT
GCTTAAAAATGACAAGAAAAAATAA
Antitoxin
Download Length: 256 bp
>AT10204 NC_004668:c3119134-3118879 [Enterococcus faecalis V583]
ATAAAAATGCCCGAGCCTTGAAATAGGAGGCTCAGGCATTTTTTATTGATGGTCTTTTTAGGGTTGTTGTGCTATAATGA
TAAAGAAAAGAGAGATATGCTTCCAACATATCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCAATTTTATTATTTAAA
AATAACCGTGCTTGGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCAATCAAAGCA
ATGGTAAACATACCAA
ATAAAAATGCCCGAGCCTTGAAATAGGAGGCTCAGGCATTTTTTATTGATGGTCTTTTTAGGGTTGTTGTGCTATAATGA
TAAAGAAAAGAGAGATATGCTTCCAACATATCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCAATTTTATTATTTAAA
AATAACCGTGCTTGGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCAATCAAAGCA
ATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Loading, please wait
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10207 | Enterococcus faecalis V583 | 53.846 | 100 | 0.538 |
| T10154 | Staphylococcus aureus subsp. aureus MW2 | 55.172 | 85.294 | 0.471 |
| T10146 | Staphylococcus aureus strain HG003 isolate RN1 Scaffold_5 | 55.172 | 85.294 | 0.471 |
| T6360 | Staphylococcus aureus subsp. aureus N315 | 55.172 | 85.294 | 0.471 |
| T10205 | Enterococcus faecalis V583 | 41.176 | 100 | 0.412 |
| T6322 | Bacillus subtilis subsp. subtilis str. 168 | 31.579 | 100 | 0.353 |
| T10201 | Bacillus subtilis subsp. subtilis str. 168 | 40 | 86.207 | 0.345 |
| T10200 | Bacillus subtilis subsp. subtilis str. 168 | 37.037 | 90 | 0.333 |
| T6321 | Bacillus subtilis subsp. subtilis str. 168 | 29.73 | 100 | 0.324 |
Showing 1 to 9 of 9 rows
Multiple sequence alignment
Loading, please wait
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| No matching records found | ||||
Structures
Toxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| No matching records found | ||
Antitoxin
Download structure file
References
(1) Elizabeth M Fozo et al. (2010) Abundance of type I toxin-antitoxin systems in bacteria: searches for new candidates and discovery of novel families. Nucleic Acids Research 38(11):3743-59. [PubMed:20156992]