Detailed information of TA system
Experimentally validatedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 34711..35007 | Replicon | chromosome |
Accession | NZ_JPPU01000005 | ||
Organism | Staphylococcus aureus strain HG003 isolate RN1 Scaffold_5 |
Toxin (Protein)
Gene name | SprG1 | Uniprot ID | - |
Locus tag | - | Protein ID | - |
Coordinates | 34711..34842 (+) | Length | 44 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 34833..35007 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IM26_RS18550 (IM26_03465) | 29904..33689 | + | 3786 | WP_000582137.1 | phage tail spike protein | - |
IM26_RS0113950 | 33679..33831 | + | 153 | WP_001153681.1 | hypothetical protein | - |
IM26_RS18555 (IM26_03475) | 33878..34165 | + | 288 | WP_001040261.1 | hypothetical protein | - |
IM26_RS0113955 (IM26_03480) | 34223..34519 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
- | 34711..34842 | + | 132 | - | - | Toxin |
- | 34833..35007 | - | 175 | - | - | Antitoxin |
IM26_RS18560 (IM26_03490) | 35057..35311 | + | 255 | WP_000611512.1 | phage holin | - |
IM26_RS18565 (IM26_03495) | 35323..36078 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
IM26_RS18570 (IM26_03500) | 36269..36760 | + | 492 | WP_000920037.1 | staphylokinase | - |
IM26_RS29050 (IM26_03505) | 37410..37745 | + | 336 | Protein_62 | SH3 domain-containing protein | - |
IM26_RS18580 (IM26_03510) | 37840..38289 | - | 450 | WP_000727643.1 | chemotaxis-inhibiting protein CHIPS | - |
IM26_RS18585 (IM26_03515) | 38972..39322 | + | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
IM26_RS0113965 | 39375..39635 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | sak / chp / scn | 180..39322 | 39142 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 44 a.a. Molecular weight: 5029.35 Da Isoelectric Point: 11.7213
>T10146 - NZ_JPPU01000005:34711-34842 [Staphylococcus aureus]
MVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 132 bp
>T10146 NZ_JPPU01000005:34711-34842 [Staphylococcus aureus]
ATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCTAATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCT
TATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAATTAAGCAATAAAAAA
ATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCTAATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCT
TATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAATTAAGCAATAAAAAA
Antitoxin
Download Length: 175 bp
>AT10146 NZ_JPPU01000005:c35007-34833 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|---|---|---|---|
T10154 | Staphylococcus aureus subsp. aureus MW2 |
100 |
100 |
1 |
T6360 | Staphylococcus aureus subsp. aureus N315 |
100 |
100 |
1 |
T10025 | Staphylococcus aureus subsp. aureus N315 |
56 |
100 |
0.56 |
T10204 | Enterococcus faecalis V583 |
55.172 |
85.294 |
0.471 |
T10049 | Staphylococcus aureus strain HG003 isolate RN1 Scaffold_9 |
56 |
71.429 |
0.4 |
T10207 | Enterococcus faecalis V583 |
36 |
96.154 |
0.346 |
T10201 | Bacillus subtilis subsp. subtilis str. 168 |
52.941 |
58.621 |
0.31 |
Multiple sequence alignment
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
References
(1) Camille Riffaud et al. (2019) Functionality and cross-regulation of the four SprG/SprF type I toxin-antitoxin systems in Staphylococcus aureus. Nucleic Acids Research 47(4):1740-1758. [PubMed:30551143]
experimental literature