Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 1979381..1979680 | Replicon | chromosome |
| Accession | NZ_LR133917 | ||
| Organism | Staphylococcus aureus strain NCTC8317 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | ELZ45_RS10105 | Protein ID | WP_011447039.1 |
| Coordinates | 1979504..1979680 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 1979381..1979436 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ45_RS10060 | 1974714..1974974 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| ELZ45_RS10065 | 1975027..1975377 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| ELZ45_RS10070 | 1976060..1976509 | + | 450 | WP_000727643.1 | chemotaxis-inhibiting protein CHIPS | - |
| ELZ45_RS10075 | 1976604..1976939 | - | 336 | Protein_1861 | SH3 domain-containing protein | - |
| ELZ45_RS10085 | 1977589..1978080 | - | 492 | WP_000920037.1 | staphylokinase | - |
| ELZ45_RS10090 | 1978271..1979026 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| ELZ45_RS10095 | 1979038..1979292 | - | 255 | WP_000611512.1 | phage holin | - |
| ELZ45_RS10100 | 1979344..1979451 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 1979373..1979512 | + | 140 | NuclAT_0 | - | - |
| - | 1979373..1979512 | + | 140 | NuclAT_0 | - | - |
| - | 1979373..1979512 | + | 140 | NuclAT_0 | - | - |
| - | 1979373..1979512 | + | 140 | NuclAT_0 | - | - |
| - | 1979381..1979436 | + | 56 | - | - | Antitoxin |
| ELZ45_RS10105 | 1979504..1979680 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| ELZ45_RS10110 | 1979830..1980126 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| ELZ45_RS10115 | 1980184..1980471 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| ELZ45_RS10120 | 1980518..1980670 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| ELZ45_RS10125 | 1980660..1984445 | - | 3786 | WP_126497022.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | map / hlb / scn / chp / sak / hlb / groEL | 1971533..2027773 | 56240 | ||
| inside | Prophage | - | scn / chp / sak / hlb / groEL | 1975027..2027773 | 52746 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T286510 WP_011447039.1 NZ_LR133917:c1979680-1979504 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286510 NZ_LR133917:1979381-1979436 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|