Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2046091..2046390 | Replicon | chromosome |
| Accession | NZ_LS483365 | ||
| Organism | Staphylococcus aureus subsp. aureus NCTC 8325 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | DQM91_RS10740 | Protein ID | WP_011447039.1 |
| Coordinates | 2046214..2046390 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2046091..2046146 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM91_RS10695 | 2041424..2041684 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| DQM91_RS10700 | 2041737..2042087 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| DQM91_RS10705 | 2042770..2043219 | + | 450 | WP_000727643.1 | chemotaxis-inhibiting protein CHIPS | - |
| DQM91_RS10710 | 2043314..2043649 | - | 336 | Protein_1974 | SH3 domain-containing protein | - |
| DQM91_RS10720 | 2044299..2044790 | - | 492 | WP_000920037.1 | staphylokinase | - |
| DQM91_RS10725 | 2044981..2045736 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DQM91_RS10730 | 2045748..2046002 | - | 255 | WP_000611512.1 | phage holin | - |
| DQM91_RS10735 | 2046054..2046161 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2046083..2046222 | + | 140 | NuclAT_0 | - | - |
| - | 2046083..2046222 | + | 140 | NuclAT_0 | - | - |
| - | 2046083..2046222 | + | 140 | NuclAT_0 | - | - |
| - | 2046083..2046222 | + | 140 | NuclAT_0 | - | - |
| - | 2046091..2046146 | + | 56 | - | - | Antitoxin |
| DQM91_RS10740 | 2046214..2046390 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| DQM91_RS10745 | 2046540..2046836 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DQM91_RS10750 | 2046894..2047181 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| DQM91_RS10755 | 2047228..2047380 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| DQM91_RS10760 | 2047370..2051155 | - | 3786 | WP_000582137.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | scn / chp / sak / hlb / groEL | 2041737..2097360 | 55623 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T292434 WP_011447039.1 NZ_LS483365:c2046390-2046214 [Staphylococcus aureus subsp. aureus NCTC 8325]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT292434 NZ_LS483365:2046091-2046146 [Staphylococcus aureus subsp. aureus NCTC 8325]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|