Detailed information of TA system
Experimentally validatedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2678240..2678565 | Replicon | chromosome |
Accession | NC_000964 | ||
Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
T1TAdb ID | TA04737 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | P54373 |
Locus tag | BSU26050 | Protein ID | NP_390482.1 |
Coordinates | 2678240..2678419 (+) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | BSU_misc_RNA_81 | ||
Coordinates | 2678344..2678565 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BSU_26050 (BSU26050) | 2678240..2678419 | + | 180 | NP_390482.1 | toxic peptide of toxin-antitoxin system; skin element | Toxin |
- | 2678344..2678565 | - | 222 | - | - | Antitoxin |
BSU_26055 (BSU26055) | 2678799..2678888 | + | 90 | YP_009513980.1 | skin region; type I toxin | - |
BSU_26060 (BSU26060) | 2679142..2679585 | - | 444 | NP_390483.2 | putative tail tube protein; skin element | - |
BSU_26075 (BSU26075) | 2679588..2680988 | - | 1401 | NP_390485.2 | putative phage tail sheath protein; skin element | - |
BSU_26089 (BSU26089) | 2680989..2681180 | - | 192 | YP_003097763.1 | conserved phage protein of unknown function; skin element | - |
BSU_26090 (BSU26090) | 2681177..2681614 | - | 438 | NP_390486.2 | conserved phage protein of unknown function; skin element | - |
BSU_26100 (BSU26100) | 2681627..2682130 | - | 504 | NP_390487.1 | putative phage tail component; skin element | - |
BSU_26110 (BSU26110) | 2682127..2682489 | - | 363 | NP_390488.1 | conserved phage protein of unknown function; skin element | - |
BSU_26120 (BSU26120) | 2682486..2682881 | - | 396 | NP_390489.2 | conserved phage protein of unknown function; skin element | - |
BSU_26130 (BSU26130) | 2682885..2683196 | - | 312 | NP_390490.1 | hypothetical protein; skin element | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2645490..2699243 | 53753 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T6322 NP_390482.1 NC_000964:2678240-2678419 [Bacillus subtilis subsp. subtilis str. 168]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
>T6322 NC_000964:2678240-2678419 [Bacillus subtilis subsp. subtilis str. 168]
ATGTCGACCTATGAATCTCTAATGGTCATGATCGGCTTTGCCAATTTAATAGGCGGGATTATGACATGGGTAATATCTCT
TTTAACATTATTATTCATGCTTAGAAAAAAAGACACTCATCCTATTTACATTACTGTAAAGGAAAAGTGTCTACACGAGG
ACCCTCCTATTAAAGGGTAG
ATGTCGACCTATGAATCTCTAATGGTCATGATCGGCTTTGCCAATTTAATAGGCGGGATTATGACATGGGTAATATCTCT
TTTAACATTATTATTCATGCTTAGAAAAAAAGACACTCATCCTATTTACATTACTGTAAAGGAAAAGTGTCTACACGAGG
ACCCTCCTATTAAAGGGTAG
Antitoxin
Download Length: 222 bp
>AT6322 NC_000964:c2678565-2678344 [Bacillus subtilis subsp. subtilis str. 168]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTT
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|---|---|---|---|
T10204 | Enterococcus faecalis V583 |
31.579 |
100 |
0.353 |
Multiple sequence alignment
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
References
(1) Sylvain Durand et al. (2012) Type I toxin-antitoxin systems in Bacillus subtilis. RNA Biology 9(12):1491-7. [PubMed:23059907]
(2) Jessica M Silvaggi et al. (2005) Small untranslated RNA antitoxin in Bacillus subtilis. Journal of Bacteriology 187(19):6641-50. [PubMed:16166525]
(3) Sylvain Durand et al. (2012) The essential function of B. subtilis RNase III is to silence foreign toxin genes. PLoS Genetics 8(12):e1003181. [PubMed:23300471]
experimental literature