Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2477742..2478067 | Replicon | chromosome |
Accession | NZ_CP120613 | ||
Organism | Bacillus subtilis strain DSM 23521 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | P54373 |
Locus tag | P5649_RS12855 | Protein ID | WP_004398662.1 |
Coordinates | 2477888..2478067 (-) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2477742..2477964 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5649_RS12810 (2473111) | 2473111..2473422 | + | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
P5649_RS12815 (2473426) | 2473426..2473821 | + | 396 | WP_004398566.1 | DUF3199 family protein | - |
P5649_RS12820 (2473818) | 2473818..2474180 | + | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
P5649_RS12825 (2474177) | 2474177..2474680 | + | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
P5649_RS12830 (2474693) | 2474693..2475130 | + | 438 | WP_003229927.1 | hypothetical protein | - |
P5649_RS12835 (2475127) | 2475127..2475318 | + | 192 | WP_010886574.1 | hypothetical protein | - |
P5649_RS12840 (2475319) | 2475319..2476719 | + | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
P5649_RS12845 (2476722) | 2476722..2477165 | + | 444 | WP_003229930.1 | phage tail tube protein | - |
P5649_RS12850 (2477419) | 2477419..2477508 | - | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
- (2477742) | 2477742..2477964 | + | 223 | NuclAT_0 | - | Antitoxin |
- (2477742) | 2477742..2477964 | + | 223 | NuclAT_0 | - | Antitoxin |
- (2477742) | 2477742..2477964 | + | 223 | NuclAT_0 | - | Antitoxin |
- (2477742) | 2477742..2477964 | + | 223 | NuclAT_0 | - | Antitoxin |
P5649_RS12855 (2477888) | 2477888..2478067 | - | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
P5649_RS12860 (2478213) | 2478213..2478662 | + | 450 | WP_003229933.1 | phage portal protein | - |
P5649_RS12865 (2478704) | 2478704..2478841 | + | 138 | WP_003229934.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2448623..2518763 | 70140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T275251 WP_004398662.1 NZ_CP120613:c2478067-2477888 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT275251 NZ_CP120613:2477742-2477964 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|