Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2696251..2696576 | Replicon | chromosome |
Accession | NZ_LN680001 | ||
Organism | Bacillus subtilis strain BS34A |
Toxin (Protein)
Gene name | txpA | Uniprot ID | P54373 |
Locus tag | VV28_RS13515 | Protein ID | WP_004398662.1 |
Coordinates | 2696251..2696430 (+) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2696354..2696576 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VV28_RS21880 | 2695477..2695614 | - | 138 | WP_003229934.1 | hypothetical protein | - |
VV28_RS13510 | 2695656..2696105 | - | 450 | WP_003229933.1 | phage portal protein | - |
VV28_RS13515 | 2696251..2696430 | + | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
- | 2696354..2696576 | - | 223 | NuclAT_0 | - | Antitoxin |
- | 2696354..2696576 | - | 223 | NuclAT_0 | - | Antitoxin |
- | 2696354..2696576 | - | 223 | NuclAT_0 | - | Antitoxin |
- | 2696354..2696576 | - | 223 | NuclAT_0 | - | Antitoxin |
VV28_RS22485 | 2696810..2696899 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
VV28_RS13520 | 2697153..2697596 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
VV28_RS13525 | 2697599..2698999 | - | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
VV28_RS13530 | 2699000..2699191 | - | 192 | WP_010886574.1 | hypothetical protein | - |
VV28_RS13535 | 2699188..2699625 | - | 438 | WP_003229927.1 | hypothetical protein | - |
VV28_RS13540 | 2699638..2700141 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
VV28_RS13545 | 2700138..2700500 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
VV28_RS13550 | 2700497..2700892 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
VV28_RS13555 | 2700896..2701207 | - | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2663501..2717254 | 53753 | ||
inside | Prophage | - | - | 2665764..2717254 | 51490 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T285538 WP_004398662.1 NZ_LN680001:2696251-2696430 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT285538 NZ_LN680001:c2696576-2696354 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|