Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2563876..2564201 | Replicon | chromosome |
Accession | NZ_OX419567 | ||
Organism | Bacillus subtilis isolate NRS6107 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | P54373 |
Locus tag | KJP42_RS13220 | Protein ID | WP_004398662.1 |
Coordinates | 2563876..2564055 (+) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2563979..2564201 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP42_RS13210 (2563102) | 2563102..2563239 | - | 138 | WP_003229934.1 | hypothetical protein | - |
KJP42_RS13215 (2563281) | 2563281..2563730 | - | 450 | WP_003229933.1 | phage portal protein | - |
KJP42_RS13220 (2563876) | 2563876..2564055 | + | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
- (2563979) | 2563979..2564201 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2563979) | 2563979..2564201 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2563979) | 2563979..2564201 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2563979) | 2563979..2564201 | - | 223 | NuclAT_0 | - | Antitoxin |
KJP42_RS13225 (2564435) | 2564435..2564524 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
KJP42_RS13230 (2564778) | 2564778..2565221 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
KJP42_RS13235 (2565224) | 2565224..2566624 | - | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
KJP42_RS13240 (2566625) | 2566625..2566816 | - | 192 | WP_010886574.1 | hypothetical protein | - |
KJP42_RS13245 (2566813) | 2566813..2567250 | - | 438 | WP_003229927.1 | hypothetical protein | - |
KJP42_RS13250 (2567263) | 2567263..2567766 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
KJP42_RS13255 (2567763) | 2567763..2568125 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
KJP42_RS13260 (2568122) | 2568122..2568517 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
KJP42_RS13265 (2568521) | 2568521..2568832 | - | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2531126..2584879 | 53753 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T296840 WP_004398662.1 NZ_OX419567:2563876-2564055 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT296840 NZ_OX419567:c2564201-2563979 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|