Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 1571792..1572117 | Replicon | chromosome |
Accession | NZ_CP125762 | ||
Organism | Bacillus subtilis strain KRS015 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | P54373 |
Locus tag | QLQ05_RS08195 | Protein ID | WP_004398662.1 |
Coordinates | 1571938..1572117 (-) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 1571792..1572014 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ05_RS08150 (1567161) | 1567161..1567472 | + | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
QLQ05_RS08155 (1567476) | 1567476..1567871 | + | 396 | WP_004398566.1 | DUF3199 family protein | - |
QLQ05_RS08160 (1567868) | 1567868..1568230 | + | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
QLQ05_RS08165 (1568227) | 1568227..1568730 | + | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
QLQ05_RS08170 (1568743) | 1568743..1569180 | + | 438 | WP_003229927.1 | hypothetical protein | - |
QLQ05_RS08175 (1569177) | 1569177..1569368 | + | 192 | WP_010886574.1 | hypothetical protein | - |
QLQ05_RS08180 (1569369) | 1569369..1570769 | + | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
QLQ05_RS08185 (1570772) | 1570772..1571215 | + | 444 | WP_003229930.1 | phage tail tube protein | - |
QLQ05_RS08190 (1571469) | 1571469..1571558 | - | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
- (1571792) | 1571792..1572014 | + | 223 | NuclAT_0 | - | Antitoxin |
- (1571792) | 1571792..1572014 | + | 223 | NuclAT_0 | - | Antitoxin |
- (1571792) | 1571792..1572014 | + | 223 | NuclAT_0 | - | Antitoxin |
- (1571792) | 1571792..1572014 | + | 223 | NuclAT_0 | - | Antitoxin |
QLQ05_RS08195 (1571938) | 1571938..1572117 | - | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
QLQ05_RS08200 (1572263) | 1572263..1572712 | + | 450 | WP_003229933.1 | phage portal protein | - |
QLQ05_RS08205 (1572754) | 1572754..1572891 | + | 138 | WP_003229934.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1551114..1662348 | 111234 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T282346 WP_004398662.1 NZ_CP125762:c1572117-1571938 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT282346 NZ_CP125762:1571792-1572014 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|