Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 1619869..1620195 | Replicon | chromosome |
Accession | NZ_CP125762 | ||
Organism | Bacillus subtilis strain KRS015 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | P54373 |
Locus tag | QLQ05_RS08545 | Protein ID | WP_004398662.1 |
Coordinates | 1620016..1620195 (-) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 1619869..1620092 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ05_RS08495 (1615221) | 1615221..1615533 | + | 313 | Protein_1658 | YqbF domain-containing protein | - |
QLQ05_RS08500 (1615537) | 1615537..1615935 | + | 399 | Protein_1659 | DUF3199 family protein | - |
QLQ05_RS08505 (1615932) | 1615932..1616296 | + | 365 | Protein_1660 | YqbH/XkdH family protein | - |
QLQ05_RS08510 (1616293) | 1616293..1616797 | + | 505 | Protein_1661 | HK97 gp10 family phage protein | - |
QLQ05_RS08515 (1616810) | 1616810..1617247 | + | 438 | WP_003229927.1 | hypothetical protein | - |
QLQ05_RS08520 (1617244) | 1617244..1617435 | + | 192 | WP_010886574.1 | hypothetical protein | - |
QLQ05_RS08525 (1617436) | 1617436..1618838 | + | 1403 | Protein_1664 | phage tail sheath family protein | - |
QLQ05_RS08530 (1618841) | 1618841..1619286 | + | 446 | Protein_1665 | phage tail tube protein | - |
QLQ05_RS08535 (1619507) | 1619507..1619605 | - | 99 | WP_283296538.1 | putative holin-like toxin | - |
QLQ05_RS08540 (1619586) | 1619586..1619645 | - | 60 | Protein_1667 | hypothetical protein | - |
- (1619869) | 1619869..1620092 | + | 224 | NuclAT_1 | - | Antitoxin |
- (1619869) | 1619869..1620092 | + | 224 | NuclAT_1 | - | Antitoxin |
- (1619869) | 1619869..1620092 | + | 224 | NuclAT_1 | - | Antitoxin |
- (1619869) | 1619869..1620092 | + | 224 | NuclAT_1 | - | Antitoxin |
QLQ05_RS08545 (1620016) | 1620016..1620195 | - | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
QLQ05_RS08550 (1620343) | 1620343..1620792 | + | 450 | WP_003229933.1 | phage portal protein | - |
QLQ05_RS08555 (1620829) | 1620829..1620972 | + | 144 | WP_283296297.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1551114..1662348 | 111234 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T282352 WP_004398662.1 NZ_CP125762:c1620195-1620016 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 224 bp
>AT282352 NZ_CP125762:1619869-1620092 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAAACTACCCTTTAATA
GGAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAAACTACCCTTTAATA
GGAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|